BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h10f (621 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58332| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_3796| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_5014| Best HMM Match : Galactosyl_T (HMM E-Value=1.5e-07) 30 1.7 SB_48704| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) 29 4.0 SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_49167| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_15766| Best HMM Match : Cor1 (HMM E-Value=5.2) 28 7.0 SB_37665| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_58332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 32.3 bits (70), Expect = 0.33 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 157 PYTMSVRIEKITEPLTLGEGPHWDERQQALYFVSIQDKTIH 279 P +SV ++ + E L EGPHWDE L ++ K +H Sbjct: 4 PVKVSVLLKNVGE---LCEGPHWDEASGKLVWMDCMQKLVH 41 >SB_3796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1051 Score = 31.1 bits (67), Expect = 0.75 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 5/92 (5%) Frame = +1 Query: 283 YVPTTEKHTKTSLDGRVGFILPVEGTTD-QFV---VGVER-KFLFIQWDGEDGSKVAVLK 447 Y+ + + H ++ G+ G I+ V TT+ FV V ++R +++ QW G D + Sbjct: 308 YLKSAKIHN-VNVRGKRGNIVQVFPTTEYDFVPNTVTMKRNEYVHFQWTGSDTNPANNAG 366 Query: 448 ELGEVDKDRPNNRINDGKADPRGRLFAGTMGH 543 E G+ DR N + +GKA P G T GH Sbjct: 367 E-GKAGTDRHNVLLLEGKAYPVGVSRPFTYGH 397 Score = 29.9 bits (64), Expect = 1.7 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 5/92 (5%) Frame = +1 Query: 283 YVPTTEKHTKTSLDGRVGFILPVEGTTD-QFV---VGVER-KFLFIQWDGEDGSKVAVLK 447 Y+ + + H ++ G+ G I+ V TT+ FV V ++R +++ QW G D + Sbjct: 930 YLKSAKIHN-VNVRGKRGNIVQVFPTTEYDFVPNSVTMKRNEYVHFQWTGSDTNPADNAG 988 Query: 448 ELGEVDKDRPNNRINDGKADPRGRLFAGTMGH 543 E G+ DR N + +GKA P T GH Sbjct: 989 E-GKAGTDRHNVLLLEGKAYPEAVSRPFTYGH 1019 >SB_5014| Best HMM Match : Galactosyl_T (HMM E-Value=1.5e-07) Length = 194 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = +3 Query: 300 KTYKNQFRWE----GWFHITSGRYNRPICSGSRTQVPFHT 407 K Y F W G FHI S I + +RT++PFHT Sbjct: 82 KKYYPYFEWPPFCYGLFHILSADVVPEILNHTRTRIPFHT 121 >SB_48704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = +3 Query: 300 KTYKNQFRWE----GWFHITSGRYNRPICSGSRTQVPFHT 407 K Y F W G FHI S I + +RT++PFHT Sbjct: 932 KKYYPYFEWPPFCYGLFHILSADVVPEILNHTRTRIPFHT 971 >SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) Length = 454 Score = 28.7 bits (61), Expect = 4.0 Identities = 18/86 (20%), Positives = 43/86 (50%), Gaps = 1/86 (1%) Frame = +1 Query: 214 GPHWDERQQALYFVSIQDKTIHKYVPTTEKHTKTSLDGRVGFILPVEGTTDQF-VVGVER 390 GP WD+ ++++ + + + +Y+PT + + L+ R+ + +G ++ VV +E Sbjct: 73 GPDWDKYRESIKSQVTRPRELAEYIPTFNQISDELLE-RLNSLRTPKGRNYEYEVVNLEE 131 Query: 391 KFLFIQWDGEDGSKVAVLKELGEVDK 468 + I+W E + + G ++K Sbjct: 132 E--LIKWSFETATYAMFNQRFGYMEK 155 >SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 514 GRLFAGTMGHEDPPGNFERNKASLYKLDSAK 606 G L +GHE+ PG E+ KA+L ++ + + Sbjct: 36 GSLEDEVLGHEEDPGMMEKKKAALKRMGARR 66 >SB_49167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 514 GRLFAGTMGHEDPPGNFERNKASLYKLDSAK 606 G L +GHE+ PG E+ KA+L ++ + + Sbjct: 36 GSLEDEVLGHEEDPGMMEKKKAALKRMGARR 66 >SB_15766| Best HMM Match : Cor1 (HMM E-Value=5.2) Length = 249 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 349 VEGTTDQFVVGVERKFLF--IQWDGEDGSKVAVLKELGEVDKDRPN 480 V+G T V+G E + ++ WDG+ VLK+ GE + R N Sbjct: 47 VQGATLLTVIGEEAQDVYSTFNWDGDINKIEPVLKKFGEYCEPRRN 92 >SB_37665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 27.5 bits (58), Expect = 9.3 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -2 Query: 263 WMLTKY-SAC*RSSQWGPSPSVRGSVIFSILTDIVYGFLTKQ 141 WML + S +S Q S S+ S + S L IVYG LTKQ Sbjct: 152 WMLLDFGSKDEKSLQMLFSMSIILSAVHSCLNPIVYGTLTKQ 193 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,375,716 Number of Sequences: 59808 Number of extensions: 405908 Number of successful extensions: 882 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -