BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h10f (621 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05090.2 68416.m00553 transducin family protein / WD-40 repea... 30 1.1 At3g05090.1 68416.m00552 transducin family protein / WD-40 repea... 30 1.1 At4g28990.1 68417.m04143 RNA-binding protein-related contains we... 28 4.3 At2g21090.1 68415.m02503 pentatricopeptide (PPR) repeat-containi... 28 5.7 >At3g05090.2 68416.m00553 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 30.3 bits (65), Expect = 1.1 Identities = 24/74 (32%), Positives = 31/74 (41%) Frame = +1 Query: 253 VSIQDKTIHKYVPTTEKHTKTSLDGRVGFILPVEGTTDQFVVGVERKFLFIQWDGEDGSK 432 +S+Q H Y PT K K S+ + L + T V G K L + WD GSK Sbjct: 194 ISVQSSPSHGYTPTIAKGHKESV-----YALAMNDTGTMLVSGGTEKVLRV-WDPRTGSK 247 Query: 433 VAVLKELGEVDKDR 474 L+ G D R Sbjct: 248 SMKLR--GHTDNVR 259 >At3g05090.1 68416.m00552 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 30.3 bits (65), Expect = 1.1 Identities = 24/74 (32%), Positives = 31/74 (41%) Frame = +1 Query: 253 VSIQDKTIHKYVPTTEKHTKTSLDGRVGFILPVEGTTDQFVVGVERKFLFIQWDGEDGSK 432 +S+Q H Y PT K K S+ + L + T V G K L + WD GSK Sbjct: 194 ISVQSSPSHGYTPTIAKGHKESV-----YALAMNDTGTMLVSGGTEKVLRV-WDPRTGSK 247 Query: 433 VAVLKELGEVDKDR 474 L+ G D R Sbjct: 248 SMKLR--GHTDNVR 259 >At4g28990.1 68417.m04143 RNA-binding protein-related contains weak similarity to Swiss-Prot:Q01844 RNA-binding protein EWS (EWS oncogene)(Ewing sarcoma breakpoint region 1 protein) [Homo sapiens] Length = 347 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 412 DGEDGSKVAVLKELGEVDKDRPN-NRINDGKADPRG 516 D EDG A E GEV +DRP+ NR + K D G Sbjct: 29 DREDGRNAAGDYEPGEVSRDRPSFNRSDRYKGDNGG 64 >At2g21090.1 68415.m02503 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 597 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 172 VRIEKITEPLTLGEGPHWDERQQALYFV 255 + IEK E T+ +G H R++ +YF+ Sbjct: 555 IEIEKKVEAFTVSDGSHAHARKEEIYFI 582 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,083,531 Number of Sequences: 28952 Number of extensions: 286138 Number of successful extensions: 695 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -