BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h09r (739 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4BAX0 Cluster: Uncharacterized secreted protein; n=1; ... 33 7.3 UniRef50_Q7REN3 Cluster: Putative uncharacterized protein PY0503... 33 7.3 >UniRef50_A4BAX0 Cluster: Uncharacterized secreted protein; n=1; Reinekea sp. MED297|Rep: Uncharacterized secreted protein - Reinekea sp. MED297 Length = 241 Score = 33.1 bits (72), Expect = 7.3 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = -1 Query: 637 LLHNAIPL*MLVHISLWNWYLFQDRFTVDILRYTGRRLRVRITIRFENIY 488 L +PL H+ WNW +QD F+ RYTGR+ T R +Y Sbjct: 63 LFRGILPL--AFHVDYWNWLGWQDPFS--HTRYTGRQQAYAETKRLSQVY 108 >UniRef50_Q7REN3 Cluster: Putative uncharacterized protein PY05031; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05031 - Plasmodium yoelii yoelii Length = 1123 Score = 33.1 bits (72), Expect = 7.3 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 33 NTHDLISSLLNSITGFKHYKYSNRMSLKIYLIYN 134 N H+ + L+N I+ F Y Y+N S IY YN Sbjct: 17 NNHNNTTILMNKISYFSFYSYNNTQSNNIYYTYN 50 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,048,674 Number of Sequences: 1657284 Number of extensions: 11633194 Number of successful extensions: 19383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19354 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60088620670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -