BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h09r (739 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0521 + 3867922-3867967,3868282-3868544,3868680-3868744,386... 28 8.9 02_01_0378 - 2736361-2738355 28 8.9 >07_01_0521 + 3867922-3867967,3868282-3868544,3868680-3868744, 3868828-3868990,3869798-3869946,3870041-3870289, 3870860-3871028,3871110-3871202,3871703-3871952, 3872127-3872217,3872673-3872769 Length = 544 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -3 Query: 392 FFAMNKLNN*KM*LGYIRDVNPILLLENVCLINFYLKSTAV*KVALLAMI 243 FF NKL LG ++ V I L V L N++LK+ + K+ L I Sbjct: 310 FFITNKLGFTPEFLGRVKLVTSIASLLGVGLYNYFLKAVPLRKIFLATTI 359 >02_01_0378 - 2736361-2738355 Length = 664 Score = 27.9 bits (59), Expect = 8.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 513 ILTRKRRPVYLSISTVNRSWNRYQF 587 +L+ K RPV + T++RSW + F Sbjct: 419 LLSEKYRPVLAQVLTIHRSWRKETF 443 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,077,301 Number of Sequences: 37544 Number of extensions: 269981 Number of successful extensions: 411 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -