BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h08f (592 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0310 - 8842286-8843314 32 0.30 06_03_1283 - 28957729-28959258,28959354-28959550,28959824-289600... 31 0.91 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 29 3.7 03_02_0594 - 9695616-9696042,9696646-9697260,9697410-9697717,970... 29 3.7 10_06_0171 + 11466934-11466990,11467073-11468312,11468450-114685... 28 4.8 02_04_0260 - 21350060-21350269,21350544-21350604,21350834-213509... 28 4.8 06_03_1269 + 28865236-28865819,28866124-28866754 28 6.4 11_04_0385 - 17022367-17022597,17022738-17022797,17022912-170229... 27 8.5 10_08_0943 + 21728294-21728675,21728767-21728840,21729469-217304... 27 8.5 08_02_0707 - 20212190-20214592 27 8.5 02_04_0346 - 22183145-22183264,22183877-22183966,22184140-221842... 27 8.5 01_05_0199 - 19174971-19175105,19176302-19176628,19176813-191769... 27 8.5 >02_02_0310 - 8842286-8843314 Length = 342 Score = 32.3 bits (70), Expect = 0.30 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -1 Query: 400 NHHLHNDDHQQEDCVRDDHAVTLAYRSTA-SQERDHEHYSPDDYEDPRTDSKM 245 +HH H+D++++++ + D A R + + R H H+ DD+E + M Sbjct: 193 HHHHHHDENEEDEHEQADEASPAVERLISFHRRRHHHHHHEDDHEQREEGAPM 245 >06_03_1283 - 28957729-28959258,28959354-28959550,28959824-28960026, 28960097-28960424,28960524-28960661,28960765-28961020, 28961529-28961626,28963104-28963367,28964395-28964584 Length = 1067 Score = 30.7 bits (66), Expect = 0.91 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = -1 Query: 430 ALAVGEEEDANHHLHNDDHQQEDC 359 ++++ E D + H HN++H+ EDC Sbjct: 969 SISIEESSDHHEHHHNEEHKAEDC 992 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -1 Query: 415 EEEDANHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHEHYSPDDYEDPRT-DSKMG 242 EEE A +LH ++ED V DD E D +HY+ + R+ + +MG Sbjct: 205 EEEKARGYLHPHHLKEEDEVDDDDDEREEEMHCGGWEDDDDHYASTTTSETRSEEGEMG 263 >03_02_0594 - 9695616-9696042,9696646-9697260,9697410-9697717, 9700145-9700235,9700698-9700759,9701256-9702962, 9703789-9703870,9703972-9704057,9704855-9704968, 9705113-9705163,9705261-9705358,9707084-9707546 Length = 1367 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = -1 Query: 433 DALAVGEEEDANHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHEHYSPDD 275 DA G E+A H H C RDD V + +S+ +D++ DD Sbjct: 1209 DAKNCGSGEEAGDHDSERTHGTLPCSRDDEPVHVPSDFGSSKSQDNQRDEDDD 1261 >10_06_0171 + 11466934-11466990,11467073-11468312,11468450-11468596, 11469650-11470140 Length = 644 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 433 DALAVGEEEDANHHLHNDDHQQEDCVRDDHAV 338 D + EE+D +HH H+ H D +HA+ Sbjct: 320 DTFRIAEEDDDDHHHHHHYHGDADDDDGEHAM 351 >02_04_0260 - 21350060-21350269,21350544-21350604,21350834-21350901, 21351274-21351483,21351684-21351724,21351923-21351972, 21352084-21352172,21352265-21352339,21352539-21352656, 21352689-21352771,21352854-21352970,21353857-21354074, 21354184-21354241,21354356-21354508 Length = 516 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -2 Query: 318 QHPKNAITNITAPTTMKIHGPTARWVFSKSLTMVQFIRNATPIP 187 QH +N I MK H P +W+ L+ Q I++ P Sbjct: 187 QHWENKIQASDENGMMKEHSPLGKWIIGMKLSGPQMIKHVQEFP 230 >06_03_1269 + 28865236-28865819,28866124-28866754 Length = 404 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 277 RRGCNVRDRVLGMLWSDTRESLHGRHVRN 363 RR C+V D V +W ++HGR R+ Sbjct: 214 RRRCSVFDVVTAAIWQCRTRAIHGRRCRS 242 >11_04_0385 - 17022367-17022597,17022738-17022797,17022912-17022997, 17023056-17023218,17023540-17023598,17023693-17023798, 17023927-17023993,17024109-17024222,17024664-17025077, 17025799-17025887 Length = 462 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -2 Query: 315 HPKNAITNITAPTTMKIHGPTARWVFSKSLTMVQFIR 205 HP+ A+ + AP + P W ++ + T+ F++ Sbjct: 294 HPQRAVVLVQAPGQARTDAPVQLWYYTSTRTVPVFVQ 330 >10_08_0943 + 21728294-21728675,21728767-21728840,21729469-21730443, 21730617-21730683,21730765-21730827,21731001-21731064, 21731162-21731255,21731352-21731435,21731523-21731612, 21731708-21731735,21732117-21732596,21732679-21732740, 21732820-21732929,21733014-21733101,21733228-21733557, 21733782-21733904 Length = 1037 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 64 KCLL*NRNKK*CSQHGMWNEFCEICAILLQPGRRAPRPAASGDWSSVPDE 213 KCL N + S+ + ++F C L++ R A RPA S + +P + Sbjct: 927 KCLSVNPRCRITSEDALMHDFFAPCHDLIRQHRLARRPAPSNNLPCLPQD 976 >08_02_0707 - 20212190-20214592 Length = 800 Score = 27.5 bits (58), Expect = 8.5 Identities = 34/168 (20%), Positives = 64/168 (38%), Gaps = 23/168 (13%) Frame = -1 Query: 577 LAVVDSASVTAAFELSLQFREDSLGGLVCVSVRSLF----------E*HADAIHNALLDA 428 L +V + V +FE L+ RE S L+ VS+ L E H A + + Sbjct: 440 LVLVGALIVLESFERILEPREISTSSLLTVSIGGLVVNVIGLVFFHEEHHHAHGGSCSHS 499 Query: 427 LAVGEEEDANH-HLHNDDHQQEDCVRDDHAV--------TLAYRSTASQERDHEHY---- 287 + +H H H+ H ED DHA+ + A++ H+H+ Sbjct: 500 HSHSHSHSHSHSHSHSHVHGHEDHHNHDHALQGVNHNGACCEHHGDANKSHHHDHHHDSS 559 Query: 286 SPDDYEDPRTDSKMGLQ*VFDHGPVHQERYSNPH*QQAEERDDQVEEE 143 + + + + T++ HG H + + H + ++ D ++ Sbjct: 560 NEESHHNSLTENSCKENHSHCHGHDHHHHHHHDHSEHHQQSGDHAHQD 607 >02_04_0346 - 22183145-22183264,22183877-22183966,22184140-22184220, 22184430-22184589,22184723-22184787,22185370-22185441, 22186163-22186327 Length = 250 Score = 27.5 bits (58), Expect = 8.5 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 10/56 (17%) Frame = +1 Query: 97 CSQHGMWNEFCEICAILLQPGRRAPRPA---------ASGDWSSVPDELD-HGQRL 234 C++ G + CEIC + +PG AP +SGDWS + LD H R+ Sbjct: 66 CNEKG--DIICEICHVSYKPGYTAPPQVHHDETTIEISSGDWSISGNRLDLHDPRI 119 >01_05_0199 - 19174971-19175105,19176302-19176628,19176813-19176915, 19178852-19178916,19179941-19180048,19180213-19180305, 19180395-19180442,19180801-19180899,19180980-19181096, 19181186-19181239,19181312-19181404,19181776-19181881, 19182050-19182084,19182173-19182259,19182385-19182462, 19182528-19182596,19182682-19182780,19183644-19183685, 19184498-19184570,19184654-19184982,19185070-19185127, 19185217-19185269,19186075-19186144,19186276-19186337, 19186452-19186540,19186906-19187011,19187110-19187178, 19187295-19187330 Length = 900 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -1 Query: 400 NHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHEHYSPDDYED 266 +HH DD E +DD + + S + R H H S D E+ Sbjct: 823 HHHDTADDVSSERDEKDDSKKSRRHSSDRKKSRKHTHASDSDSEN 867 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,455,828 Number of Sequences: 37544 Number of extensions: 295114 Number of successful extensions: 1043 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -