BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h08f (592 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04620.1 68415.m00470 cation efflux family protein potential ... 33 0.14 At1g32400.2 68414.m03998 senescence-associated family protein co... 31 0.57 At1g32400.1 68414.m03997 senescence-associated family protein co... 31 0.57 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 31 0.76 At1g15730.1 68414.m01887 PRLI-interacting factor L, putative str... 30 1.0 At2g27940.1 68415.m03387 zinc finger (C3HC4-type RING finger) fa... 30 1.3 At3g13960.1 68416.m01762 expressed protein identical to transcri... 29 2.3 At2g20100.1 68415.m02348 ethylene-responsive family protein simi... 29 2.3 At5g13150.1 68418.m01506 exocyst subunit EXO70 family protein le... 29 3.1 At1g55600.1 68414.m06364 WRKY family transcription factor simila... 28 4.1 At5g61330.1 68418.m07696 rRNA processing protein-related contain... 28 5.4 At5g47920.1 68418.m05919 expressed protein similar to unknown pr... 28 5.4 At2g29080.1 68415.m03535 FtsH protease, putative similar to AAA-... 27 9.4 At1g07050.1 68414.m00751 CONSTANS-like protein-related contains ... 27 9.4 At1g03270.1 68414.m00305 expressed protein contains Pfam profile... 27 9.4 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 33.1 bits (72), Expect = 0.14 Identities = 17/72 (23%), Positives = 32/72 (44%) Frame = -1 Query: 463 HADAIHNALLDALAVGEEEDANHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHEHYS 284 H H+ D+ E + +HH H+ H+ E+C +H S +E +H H Sbjct: 577 HKHEEHHQHSDSHKHEEHHEHDHHHHSHSHKHEEC-NHNHDHEHQSHSHNHEECNHNHDH 635 Query: 283 PDDYEDPRTDSK 248 D++ +++ K Sbjct: 636 HSDHQPEKSEKK 647 Score = 30.7 bits (66), Expect = 0.76 Identities = 22/96 (22%), Positives = 42/96 (43%), Gaps = 2/96 (2%) Frame = -1 Query: 409 EDANHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHEHYS-PDDYEDPRTDSKMGLQ* 233 ++ HH H+D H+ E + H + +++ E DH H+S +E+ + Q Sbjct: 566 KNEEHHQHSDSHKHE----EHHQHSDSHKHEEHHEHDHHHHSHSHKHEECNHNHDHEHQ- 620 Query: 232 VFDHGPVHQE-RYSNPH*QQAEERDDQVEEE*HIFH 128 H H+E +++ H + + +E HI H Sbjct: 621 --SHSHNHEECNHNHDHHSDHQPEKSEKKEHRHIDH 654 >At1g32400.2 68414.m03998 senescence-associated family protein contains Pfam profile PF00335: Tetraspanin family Length = 280 Score = 31.1 bits (67), Expect = 0.57 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 263 WIFIVVGAVMFVIAFLGCCGAIRESHCMVVTYA 361 ++FI +G +FVI+ GC G S C + Y+ Sbjct: 83 YLFIGIGVALFVISCCGCVGTCSRSVCCLSCYS 115 >At1g32400.1 68414.m03997 senescence-associated family protein contains Pfam profile PF00335: Tetraspanin family Length = 280 Score = 31.1 bits (67), Expect = 0.57 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 263 WIFIVVGAVMFVIAFLGCCGAIRESHCMVVTYA 361 ++FI +G +FVI+ GC G S C + Y+ Sbjct: 83 YLFIGIGVALFVISCCGCVGTCSRSVCCLSCYS 115 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 30.7 bits (66), Expect = 0.76 Identities = 17/58 (29%), Positives = 24/58 (41%) Frame = -1 Query: 424 AVGEEEDANHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHEHYSPDDYEDPRTDS 251 +V E++ +HH H+ DH + DH DH H+S D DP S Sbjct: 302 SVNEDDKGDHHDHDHDHHHDHNHDHDH--------HHHDGHDHHHHSHDHTHDPGVSS 351 >At1g15730.1 68414.m01887 PRLI-interacting factor L, putative strong similarity to PRLI-interacting factor L GI:11139268 from [Arabidopsis thaliana]; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 448 Score = 30.3 bits (65), Expect = 1.0 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -1 Query: 424 AVGEEEDANHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHE-HYSPDDYEDPRTDS 251 +V EEE + H+D H DC DH + E +HE H+S D DP S Sbjct: 305 SVNEEEKEDREGHDDHHHGHDC--HDH------HNEHEHEHEHEHHHSHDHTHDPGVGS 355 >At2g27940.1 68415.m03387 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 237 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 341 SDSRVSLHSIPRTRSRTLQPRRL 273 S S V + S+PRTRS + PRRL Sbjct: 78 SSSTVDISSMPRTRSSRMSPRRL 100 >At3g13960.1 68416.m01762 expressed protein identical to transcription activator GRL5 [Arabidopsis thaliana] GI:21539888 (unpublished); supporting cDNA gi|21539887|gb|AY102638.1| Length = 397 Score = 29.1 bits (62), Expect = 2.3 Identities = 21/81 (25%), Positives = 31/81 (38%), Gaps = 2/81 (2%) Frame = -1 Query: 463 HADAIHNALLDALAVGEEEDANHHLHND-DHQQEDC-VRDDHAVTLAYRSTASQERDHEH 290 H HN + D ++ HLH+D DH+Q+ C V RS + + Sbjct: 291 HCSTDHNKI-DHHHTYSSSSSSQHLHHDHDHRQQQCFVLGADMFNKPTRSVLANSSRQDQ 349 Query: 289 YSPDDYEDPRTDSKMGLQ*VF 227 +D +D SK L F Sbjct: 350 NQEEDEKDSSESSKKSLHHFF 370 >At2g20100.1 68415.m02348 ethylene-responsive family protein similar to Ethylene-regulated ER33 protein (GI:5669656) [Lycopersicon esculentum]; PMID: 12679534; putative bHLH133 transcription factor Length = 362 Score = 29.1 bits (62), Expect = 2.3 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = -1 Query: 454 AIHNALLDALAVGEEEDA---NHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERD 299 ++ LL L +GEEE NHH H + HQ R + R AS +++ Sbjct: 94 SLSQLLLGGLMMGEEEKMEMMNHHHHQNQHQSYQAKRIQNWEEQVLRHQASMKQE 148 >At5g13150.1 68418.m01506 exocyst subunit EXO70 family protein leucine zipper-containing protein - Lycopersicon esculentum, EMBL:Z12127 contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 653 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = -1 Query: 418 GEEEDANHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHEH 290 G AN N DH+ ED H+ L + SQ EH Sbjct: 5 GNHHHANESSENHDHKSEDHENKQHSDELHSSTPESQSESSEH 47 >At1g55600.1 68414.m06364 WRKY family transcription factor similar to SPF1 protein GI:484261 from [Ipomoea batatas]; contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 485 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/68 (23%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = -1 Query: 460 ADAIHNALLDALAV--GEEEDANHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHEHY 287 ++ + +A D +++ E ED N ++D Q ED D + +E+D ++ Sbjct: 204 SELVDDAHTDIISIEDSESEDGNKDDDDEDFQYEDEDEDQYDQDQDVDEDEEEEKDEDNV 263 Query: 286 SPDDYEDP 263 + DD + P Sbjct: 264 ALDDPQPP 271 >At5g61330.1 68418.m07696 rRNA processing protein-related contains weak similarity to rRNA processing protein EBP2 (EBNA1-binding protein homolog) (Swiss-Prot:P36049) [Saccharomyces cerevisiae] Length = 436 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/58 (24%), Positives = 24/58 (41%) Frame = -1 Query: 421 VGEEEDANHHLHNDDHQQEDCVRDDHAVTLAYRSTASQERDHEHYSPDDYEDPRTDSK 248 + ++E+ N+D Q D + DD ++ S+E D DD D D + Sbjct: 20 ISDQENLKAESDNEDDQLPDGIEDDEVDSMEDDEGESEEDDEGDTEEDDEGDSEEDDE 77 >At5g47920.1 68418.m05919 expressed protein similar to unknown protein (emb|CAB67623.1) Length = 187 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -1 Query: 397 HHL--HNDDHQQEDCVRDDHAVTLAYRSTASQERDHEHYSPDDYEDPR 260 HHL H D D +D + + Y S AS HE Y + E + Sbjct: 58 HHLLGHADQDDDNDQDQDKNKAIVLYNSKASTMAHHEEYDVHEEESDK 105 >At2g29080.1 68415.m03535 FtsH protease, putative similar to AAA-metalloprotease FtsH [Pisum sativum] GI:15021761; contains Pfam profiles PF01434: Peptidase family M41, PF00004: ATPase AAA family Length = 809 Score = 27.1 bits (57), Expect = 9.4 Identities = 8/27 (29%), Positives = 19/27 (70%) Frame = -1 Query: 328 YRSTASQERDHEHYSPDDYEDPRTDSK 248 + A +++++E+Y P D ++P++D K Sbjct: 83 FSDEAPKKKNYENYFPKDKQEPKSDQK 109 >At1g07050.1 68414.m00751 CONSTANS-like protein-related contains similarity to photoperiod sensitivity quantitative trait locus (Hd1) GI:11094203 from [Oryza sativa]; similar to Zinc finger protein constans-like 15 (SP:Q9FHH8) {Arabidopsis thaliana} Length = 195 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -1 Query: 373 QQEDCVRDDHAVTLAYRSTASQERDHEHYSPDDYE 269 ++E+ +DH ++ + S RD ++S DD+E Sbjct: 8 KKEEEEEEDHLLSSTFESINGHSRDQHNHSIDDFE 42 >At1g03270.1 68414.m00305 expressed protein contains Pfam profile PF01595: Domain of unknown function Length = 499 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 260 PWIFIVVGAVMFVIAFLG 313 PW F+VVG F++ F G Sbjct: 31 PWWFVVVGVACFLVLFAG 48 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,296,514 Number of Sequences: 28952 Number of extensions: 223705 Number of successful extensions: 799 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -