BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h07f (596 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 46 2e-05 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 45 4e-05 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 44 8e-05 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 44 8e-05 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 44 8e-05 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 44 8e-05 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 44 1e-04 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 42 2e-04 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 42 4e-04 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 42 4e-04 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 42 4e-04 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 42 4e-04 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 41 5e-04 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 41 5e-04 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 41 7e-04 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 40 0.001 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 40 0.001 At1g69250.1 68414.m07936 nuclear transport factor 2 (NTF2) famil... 39 0.003 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 38 0.004 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 38 0.004 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 38 0.005 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 38 0.005 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 38 0.005 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 38 0.005 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 38 0.005 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 37 0.009 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 37 0.009 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 37 0.009 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 37 0.009 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 37 0.012 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 37 0.012 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 36 0.016 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 36 0.016 At1g69250.2 68414.m07935 nuclear transport factor 2 (NTF2) famil... 36 0.016 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 36 0.027 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 36 0.027 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 36 0.027 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 36 0.027 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 36 0.027 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 35 0.036 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 35 0.036 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 35 0.036 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 35 0.036 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 35 0.047 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 35 0.047 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 35 0.047 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 34 0.063 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 34 0.083 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 34 0.083 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 34 0.083 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 34 0.083 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 34 0.083 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 34 0.083 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 33 0.11 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 33 0.11 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 33 0.14 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 33 0.14 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 33 0.14 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 33 0.14 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 33 0.19 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 33 0.19 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 33 0.19 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 32 0.25 At1g43680.1 68414.m05018 hypothetical protein 32 0.25 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 32 0.33 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 32 0.33 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 32 0.33 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 32 0.33 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 32 0.33 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 32 0.33 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 32 0.33 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 31 0.44 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 31 0.44 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 31 0.44 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 31 0.44 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 31 0.44 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 31 0.58 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 31 0.58 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 31 0.58 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 31 0.77 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 30 1.0 At1g31550.1 68414.m03871 GDSL-motif lipase, putative similar to ... 30 1.0 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 30 1.0 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 30 1.3 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 30 1.3 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 30 1.3 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 30 1.3 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 30 1.3 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 30 1.3 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 29 1.8 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 29 1.8 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 29 1.8 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 29 1.8 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 29 1.8 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 29 1.8 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 29 2.4 At5g51300.2 68418.m06360 splicing factor-related contains simila... 29 2.4 At5g51300.1 68418.m06359 splicing factor-related contains simila... 29 2.4 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 29 2.4 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 29 2.4 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 29 2.4 At2g47310.1 68415.m05906 flowering time control protein-related ... 29 2.4 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 29 2.4 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 29 2.4 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 29 2.4 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 29 2.4 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 29 3.1 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 29 3.1 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 29 3.1 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 29 3.1 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 29 3.1 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 28 4.1 At5g22930.1 68418.m02681 hypothetical protein 28 4.1 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 28 4.1 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 28 4.1 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 28 4.1 At2g40475.1 68415.m04995 expressed protein 28 4.1 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 28 4.1 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 28 5.4 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 27 7.2 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 27 7.2 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 27 7.2 At1g13730.1 68414.m01612 nuclear transport factor 2 (NTF2) famil... 27 7.2 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 27 9.5 At4g30250.1 68417.m04301 AAA-type ATPase family protein contains... 27 9.5 At1g27650.1 68414.m03379 U2 snRNP auxiliary factor small subunit... 27 9.5 At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 27 9.5 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 27 9.5 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 46.0 bits (104), Expect = 2e-05 Identities = 22/60 (36%), Positives = 33/60 (55%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTFNGG 314 V+VG+ ++ DL +LF +FG V D+ + FV+ + E A AIR N+TF G Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRVKRVDMKSGYAFVYFEDERDAEDAIRRTDNTTFGYG 63 Score = 38.3 bits (85), Expect = 0.004 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 123 PQTKVFVGSL-PQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNS 299 P +FV + P ++ D+ + FE +G V + FV T+E A A+ + HNS Sbjct: 93 PTKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQEDATKALDSTHNS 152 Query: 300 TFNGGVISVE 329 V+SVE Sbjct: 153 KLLDKVVSVE 162 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 44.8 bits (101), Expect = 4e-05 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 7/67 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRA 287 T V+V +L + E+L K+F FGV T C IM GFV+ + + AA A+ A Sbjct: 224 TNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKSKGFGFVNFENSDDAARAVDA 283 Query: 288 LHNSTFN 308 L+ TF+ Sbjct: 284 LNGKTFD 290 Score = 31.1 bits (67), Expect = 0.58 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 7/62 (11%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRA 287 + ++V +L + + LR+ F FG +T C +M GFV T E+A AI Sbjct: 327 SNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPSGVSRGSGFVAFSTPEEATRAITE 386 Query: 288 LH 293 ++ Sbjct: 387 MN 388 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 44.0 bits (99), Expect = 8e-05 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 9/75 (12%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 287 K+FVGS+P+ + E++R FE+ G V E ++ C FV T + A AIRA Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRA 180 Query: 288 LHNS-TFNGGVISVE 329 LHN T GG V+ Sbjct: 181 LHNQITLPGGTGPVQ 195 Score = 35.5 bits (78), Expect = 0.027 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 7/65 (10%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 290 K+FVGSL + + +++ ++F +FG V + +M CGFV ++E A AAI L Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSKETAMAAIDGL 271 Query: 291 HNSTF 305 N T+ Sbjct: 272 -NGTY 275 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 44.0 bits (99), Expect = 8e-05 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 9/75 (12%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 287 K+FVGS+P+ + E++R FE+ G V E ++ C FV T + A AIRA Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRA 180 Query: 288 LHNS-TFNGGVISVE 329 LHN T GG V+ Sbjct: 181 LHNQITLPGGTGPVQ 195 Score = 35.5 bits (78), Expect = 0.027 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 7/65 (10%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 290 K+FVGSL + + +++ ++F +FG V + +M CGFV ++E A AAI L Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSKETAMAAIDGL 271 Query: 291 HNSTF 305 N T+ Sbjct: 272 -NGTY 275 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 44.0 bits (99), Expect = 8e-05 Identities = 23/77 (29%), Positives = 45/77 (58%), Gaps = 7/77 (9%) Frame = +3 Query: 120 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDI------MNR-CGFVHMQTEEQAAAA 278 + +T++ ++P S PED+R LFE++G V + ++ NR F+ M + E+AA A Sbjct: 91 ISKTRLIAQNVPWTSTPEDIRSLFEKYGSVIDIEMSMHKKERNRGLVFIEMASPEEAATA 150 Query: 279 IRALHNSTFNGGVISVE 329 +++L + + G + V+ Sbjct: 151 LKSLESCEYEGRRLKVD 167 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 44.0 bits (99), Expect = 8e-05 Identities = 21/57 (36%), Positives = 32/57 (56%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTF 305 VFVG+ ++ DL +LF+++G V D+ + FV+ + E A AIR L N F Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRVDMKSGYAFVYFEDERDAEDAIRKLDNFPF 60 Score = 41.9 bits (94), Expect = 3e-04 Identities = 25/70 (35%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 123 PQTKVFVGSL-PQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNS 299 P +FV + P +K D+ K FE +G VT I FV +T+E A A+ A S Sbjct: 91 PTKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRNFSFVQFETQEDATKALEATQRS 150 Query: 300 TFNGGVISVE 329 V+SVE Sbjct: 151 KILDRVVSVE 160 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 8/68 (11%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIRA 287 ++FVGSL +G+ EDL+K+F G VTE I+ F+ T EQA A++ Sbjct: 215 EIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKE 274 Query: 288 LHNSTFNG 311 L + NG Sbjct: 275 LKSPMING 282 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 426 RHAPPPRDAPYMRDRPGPVRGYERGPPAAPY 518 R PPP A R P P R Y+R PP Y Sbjct: 559 RPMPPPARA---RPLPPPARSYDRRPPVPLY 586 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 42.3 bits (95), Expect = 2e-04 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 7/73 (9%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM------NRC-GFVHMQTEEQAAAAIRA 287 T V+V +LP+ ++LRK F +FGV++ +M +RC GFV+ + E AA+A+ Sbjct: 229 TNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGNSRCFGFVNFECTEAAASAVEK 288 Query: 288 LHNSTFNGGVISV 326 ++ + V+ V Sbjct: 289 MNGISLGDDVLYV 301 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 7/65 (10%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTEC----DIMNRC---GFVHMQTEEQAAAAIRALH 293 +F+ +L + L + F FG + C D+ R GFV + EE A AAI L+ Sbjct: 138 IFIKNLDASIDNKALFETFSSFGTILSCKVAMDVTGRSKGYGFVQFEKEESAQAAIDKLN 197 Query: 294 NSTFN 308 N Sbjct: 198 GMLMN 202 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 41.5 bits (93), Expect = 4e-04 Identities = 20/52 (38%), Positives = 29/52 (55%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRAL 290 VF G+ ++ DL +LF ++G V D+ FV+M+ E A AIRAL Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRAL 55 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 41.5 bits (93), Expect = 4e-04 Identities = 20/52 (38%), Positives = 29/52 (55%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRAL 290 VF G+ ++ DL +LF ++G V D+ FV+M+ E A AIRAL Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRAL 55 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 41.5 bits (93), Expect = 4e-04 Identities = 21/57 (36%), Positives = 30/57 (52%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTF 305 VF G+ ++ DL +LF ++G V D+ FV+M+ E A AIRAL F Sbjct: 4 VFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALDRFEF 60 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 41.5 bits (93), Expect = 4e-04 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 8/77 (10%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECD-----IMNR---CGFVHMQTEEQAAAA 278 P+TK++V L + + LR FE+FG + + + NR F+ +TEE+A A Sbjct: 75 PKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEEAMKA 134 Query: 279 IRALHNSTFNGGVISVE 329 I+ +H +G VI VE Sbjct: 135 IQGMHGKFLDGRVIFVE 151 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 41.1 bits (92), Expect = 5e-04 Identities = 22/67 (32%), Positives = 33/67 (49%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTFN 308 T+++VG L ++ DL +LF R+G V + D+ FV A A L F+ Sbjct: 11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADDARYYLDGRDFD 70 Query: 309 GGVISVE 329 G I+VE Sbjct: 71 GSRITVE 77 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 41.1 bits (92), Expect = 5e-04 Identities = 22/67 (32%), Positives = 33/67 (49%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTFN 308 T+++VG L ++ DL +LF R+G V + D+ FV A A L F+ Sbjct: 11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDARHYLDGRDFD 70 Query: 309 GGVISVE 329 G I+VE Sbjct: 71 GSRITVE 77 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 40.7 bits (91), Expect = 7e-04 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 8/74 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIR 284 TK+++G L G+ L+ F F VTE +M GFV+ +E+ A +AI Sbjct: 31 TKLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAIS 90 Query: 285 ALHNSTFNGGVISV 326 A++ NG ISV Sbjct: 91 AMNGQELNGFNISV 104 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 40.3 bits (90), Expect = 0.001 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 10/83 (12%) Frame = +3 Query: 102 YKSVIMVPQ--TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHM 251 Y ++ +P ++VF+G LP+ EDLR L E G + E +M FV Sbjct: 105 YSHLLSLPPHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAF 164 Query: 252 QTEEQAAAAIRALHNSTFNGGVI 320 +T++ A AI LH+ F G I Sbjct: 165 KTKDVAQKAIEELHSKEFKGKTI 187 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 7/64 (10%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAI 281 P+ K+FVG LP+ +++ LF +G + + I+ C F+ +++EQA AA+ Sbjct: 107 PEHKLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAM 166 Query: 282 RALH 293 AL+ Sbjct: 167 EALN 170 >At1g69250.1 68414.m07936 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) Length = 427 Score = 38.7 bits (86), Expect = 0.003 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 10/77 (12%) Frame = +3 Query: 105 KSVIMVPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR---------C-GFVHMQ 254 + VI VP T +FV +LP + P L +LF+ FG + E I R C GF+ + Sbjct: 272 QKVIEVPGTSIFVANLPLNAMPPQLFELFKDFGPIKENGIQVRSSRGNANPVCFGFISFE 331 Query: 255 TEEQAAAAIRALHNSTF 305 T + ++A N+ F Sbjct: 332 TVASVQSVLQAAKNTPF 348 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNST 302 T +FVG++ Q +DL+ +F +FG + I RCGFV A A+ L+ + Sbjct: 278 TTIFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSVLNGTQ 337 Query: 303 FNG 311 G Sbjct: 338 LGG 340 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 38.3 bits (85), Expect = 0.004 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 123 PQTKVFVGSL-PQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNS 299 P +FV + P ++ D+ + FE +G V + FV T+E A A+ + HNS Sbjct: 67 PTKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQEDATKALDSTHNS 126 Query: 300 TFNGGVISVE 329 V+SVE Sbjct: 127 KLLDKVVSVE 136 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 37.9 bits (84), Expect = 0.005 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 8/74 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 284 +++FVG L DL + F RFG + +C IM GF+ +IR Sbjct: 7 SRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIR 66 Query: 285 ALHNSTFNGGVISV 326 +H F VISV Sbjct: 67 EMHGRDFGDRVISV 80 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 7/61 (11%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 290 K+FVG LP+ +++ LF ++G + + I+ C F+ +T+EQA +A+ ++ Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAMESI 166 Query: 291 H 293 + Sbjct: 167 N 167 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 8/63 (12%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 287 K+FVG +P+ L LF+ F VV E +I+ C F+ + E+A + A Sbjct: 19 KLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNA 78 Query: 288 LHN 296 HN Sbjct: 79 CHN 81 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 7/61 (11%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 290 K+FVG LP+ +++ LF ++G + + I+ C F+ +T+EQA +A+ ++ Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAMESI 166 Query: 291 H 293 + Sbjct: 167 N 167 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 8/63 (12%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 287 K+FVG +P+ L LF+ F VV E +I+ C F+ + E+A + A Sbjct: 19 KLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNA 78 Query: 288 LHN 296 HN Sbjct: 79 CHN 81 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 37.9 bits (84), Expect = 0.005 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 8/75 (10%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAI 281 ++++FVG L L F+R+G +TEC IM GF+ A AI Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAI 70 Query: 282 RALHNSTFNGGVISV 326 + +H VISV Sbjct: 71 KHMHGRELGNKVISV 85 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 37.9 bits (84), Expect = 0.005 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 8/75 (10%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAI 281 ++++FVG L L F+R+G +TEC IM GF+ A AI Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAI 70 Query: 282 RALHNSTFNGGVISV 326 + +H VISV Sbjct: 71 KHMHGRELGNKVISV 85 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.1 bits (82), Expect = 0.009 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 8/74 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 284 +K+FVG L G+ L++ F FG VTE ++ GFV E+ A AI+ Sbjct: 35 SKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIK 94 Query: 285 ALHNSTFNGGVISV 326 + NG I V Sbjct: 95 EMDGKELNGRQIRV 108 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.1 bits (82), Expect = 0.009 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 8/74 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 284 +K+FVG L G+ L++ F FG VTE ++ GFV E+ A AI+ Sbjct: 35 SKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIK 94 Query: 285 ALHNSTFNGGVISV 326 + NG I V Sbjct: 95 EMDGKELNGRQIRV 108 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 37.1 bits (82), Expect = 0.009 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNST 302 T VFVG L + L+ +F ++G + I RCGFV + A A+R L+ Sbjct: 261 TTVFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQ 320 Query: 303 FNGGVI 320 G + Sbjct: 321 LGGTTV 326 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 37.1 bits (82), Expect = 0.009 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 7/61 (11%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 290 K+FVG LP+ +++ LF +G + + I+ C F+ +++EQA AA+ AL Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAMEAL 160 Query: 291 H 293 + Sbjct: 161 N 161 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 36.7 bits (81), Expect = 0.012 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 8/75 (10%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-NR-------CGFVHMQTEEQAAAAI 281 + K+FVG+LP + L LFE+ G V +++ NR GFV M T E+A A+ Sbjct: 112 EAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAV 171 Query: 282 RALHNSTFNGGVISV 326 ++ NG ++V Sbjct: 172 EKFNSFEVNGRRLTV 186 Score = 32.3 bits (70), Expect = 0.25 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 8/73 (10%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 287 +++VG+LP L +LF G V + +++ GFV M E + AI A Sbjct: 208 RIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 Query: 288 LHNSTFNGGVISV 326 L G I V Sbjct: 268 LDGQNLEGRAIKV 280 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 36.7 bits (81), Expect = 0.012 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 5/62 (8%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN-----RCGFVHMQTEEQAAAAIRALH 293 TK+FVG+L + +DLR+ FE+FG V + ++++ R T + +RAL Sbjct: 12 TKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRALQ 71 Query: 294 NS 299 NS Sbjct: 72 NS 73 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 36.3 bits (80), Expect = 0.016 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNST 302 T +FVG L ++L+ +F +FG + I RCGFV + A A+ L+ + Sbjct: 260 TTIFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQ 319 Query: 303 FNG 311 G Sbjct: 320 LGG 322 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 36.3 bits (80), Expect = 0.016 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCG--FVHMQTEEQAAAAIRALHNSTFN 308 ++VGSL + DL +LF R+G + + + G F++ + E+A AA AL + N Sbjct: 20 LWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRHVEEAVAAKEALQGANLN 79 Query: 309 G 311 G Sbjct: 80 G 80 >At1g69250.2 68414.m07935 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) Length = 389 Score = 36.3 bits (80), Expect = 0.016 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +3 Query: 105 KSVIMVPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR 233 + VI VP T +FV +LP + P L +LF+ FG + E I R Sbjct: 272 QKVIEVPGTSIFVANLPLNAMPPQLFELFKDFGPIKENGIQVR 314 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 35.5 bits (78), Expect = 0.027 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 8/73 (10%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 287 + FVG L + EDL++ F +FG V + I+N GFV + E+ AI Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 288 LHNSTFNGGVISV 326 ++ +G VI+V Sbjct: 67 MNGKELDGRVITV 79 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 35.5 bits (78), Expect = 0.027 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 8/73 (10%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 287 + FVG L + EDL++ F +FG V + I+N GFV + E+ AI Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 288 LHNSTFNGGVISV 326 ++ +G VI+V Sbjct: 67 MNGKELDGRVITV 79 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 35.5 bits (78), Expect = 0.027 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 8/73 (10%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 287 + FVG L + EDL++ F +FG V + I+N GFV + E+ AI Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 288 LHNSTFNGGVISV 326 ++ +G VI+V Sbjct: 67 MNGKELDGRVITV 79 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 35.5 bits (78), Expect = 0.027 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 8/74 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 284 TK+F+G L G+ LR F FG V + ++ GFV+ E A AAI Sbjct: 35 TKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAIS 94 Query: 285 ALHNSTFNGGVISV 326 + NG I V Sbjct: 95 EMDGKELNGRHIRV 108 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 35.5 bits (78), Expect = 0.027 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 8/74 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 284 TK+F+G L G+ LR F FG V + ++ GFV+ E A AAI Sbjct: 35 TKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAIS 94 Query: 285 ALHNSTFNGGVISV 326 + NG I V Sbjct: 95 EMDGKELNGRHIRV 108 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 35.1 bits (77), Expect = 0.036 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 8/76 (10%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDI-------MNR-CGFVHMQTEEQAAAAI 281 + V V +L + ++ DL +LF FG VT C + M+R GFV + E A AI Sbjct: 173 ENSVRVTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAI 232 Query: 282 RALHNSTFNGGVISVE 329 L+ ++ ++ VE Sbjct: 233 NKLNGYGYDNLILRVE 248 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 35.1 bits (77), Expect = 0.036 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHN 296 P ++VG+LP G +L F RFG + FV+ +E A AAI +L Sbjct: 21 PSRHLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESLQG 80 Query: 297 STFNGGVISVE 329 +G + +E Sbjct: 81 FPLSGNPLRIE 91 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 35.1 bits (77), Expect = 0.036 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNSTFN 308 +FVG + EDLR+ F +FG V I CGFV + A AI +L+ + Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIG 382 Query: 309 GGVI 320 + Sbjct: 383 KNTV 386 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 35.1 bits (77), Expect = 0.036 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +3 Query: 120 VPQTKVFVGSLPQGSKPEDLRKLFERFG--VVTECDIMNRCGFVHMQTEEQAAAAIRALH 293 + T +FVG L EDL++ F FG V + + CGFV A A+ L+ Sbjct: 301 IMNTTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLN 360 Query: 294 NS 299 + Sbjct: 361 GT 362 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 34.7 bits (76), Expect = 0.047 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +3 Query: 141 VGSLPQGSKPEDLRKLFERFGVVTECDIMN--RCGFVHMQTEEQAAAAIRALHNSTFNGG 314 V +L E LR+LF G V +C I + ++ E+A AA+ AL+N+ G Sbjct: 355 VSNLSPSLTTEQLRQLFSFCGTVVDCSITDSKHIAYIEYSNSEEATAAL-ALNNTEVFGR 413 Query: 315 VISVE 329 ++VE Sbjct: 414 ALNVE 418 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 34.7 bits (76), Expect = 0.047 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFG--VVTECDIMNRCGFVHMQTEEQAAAAIRALHNS 299 T +FVG L EDL++ F FG V + + CGFV A A+ L+ + Sbjct: 306 TTIFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGT 364 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 34.7 bits (76), Expect = 0.047 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +3 Query: 105 KSVIMVP-QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN 230 K ++M Q KV+VG+LP ++P+ LR F +FG + +++ Sbjct: 203 KKILMYESQHKVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLH 245 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 34.3 bits (75), Expect = 0.063 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 7/62 (11%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRA 287 T V+V +L + + DL++LF FG +T +M R GFV+ + E A AI Sbjct: 119 TNVYVKNLVETATDADLKRLFGEFGEITSAVVMKDGEGKSRRFGFVNFEKAEAAVTAIEK 178 Query: 288 LH 293 ++ Sbjct: 179 MN 180 Score = 30.3 bits (65), Expect = 1.0 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 7/56 (12%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAI 281 ++V +L L +LF FG +T C +M GFV T E+A+ A+ Sbjct: 225 LYVKNLDDSVDNTKLEELFSEFGTITSCKVMVHSNGISKGVGFVEFSTSEEASKAM 280 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 33.9 bits (74), Expect = 0.083 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 8/77 (10%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 278 P T +FV L + + E LR F +FG V + ++ GFV T E +A Sbjct: 54 PSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKG 113 Query: 279 IRALHNSTFNGGVISVE 329 I + +G VI E Sbjct: 114 IAGMDGKFLDGWVIFAE 130 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 33.9 bits (74), Expect = 0.083 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 8/72 (11%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIRAL 290 + + +LP ++P DLR FERFG + + + GFV + E AA A++ + Sbjct: 49 LLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRM 108 Query: 291 HNSTFNGGVISV 326 ++ G I++ Sbjct: 109 NHKVIGGREIAI 120 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 33.9 bits (74), Expect = 0.083 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDI 224 K+FVG LPQ + +DLR F RFG + + I Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYI 271 Score = 30.7 bits (66), Expect = 0.77 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTE 215 T++FV +P D R FER+G +T+ Sbjct: 91 TRIFVARIPSSVSESDFRSHFERYGEITD 119 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 33.9 bits (74), Expect = 0.083 Identities = 26/73 (35%), Positives = 32/73 (43%), Gaps = 8/73 (10%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 287 KV+VG+L + E L LF G V + GFV +EE AAI A Sbjct: 178 KVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVA 237 Query: 288 LHNSTFNGGVISV 326 L+NS G I V Sbjct: 238 LNNSLLEGQKIRV 250 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 33.9 bits (74), Expect = 0.083 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALH 293 TK+FVG L ++ + +R+ FE+FG + E ++ R T ++A AA+RA Sbjct: 22 TKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQ 81 Query: 294 N 296 N Sbjct: 82 N 82 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 33.9 bits (74), Expect = 0.083 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTE----CDIMNRC---GFVHMQTEEQAAAAIRA 287 + ++V ++ E+LRK F + G +T CD + GFV T E+A A++ Sbjct: 304 SNIYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEKGKSKGFGFVCFSTPEEAIDAVKT 363 Query: 288 LHNSTFNG 311 H F+G Sbjct: 364 FHGQMFHG 371 Score = 33.5 bits (73), Expect = 0.11 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 7/63 (11%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDI-------MNRCGFVHMQTEEQAAAAIRALH 293 VFV +LP+ L+ +F++FG + C + GFV + E+ A AAI+ L Sbjct: 114 VFVKNLPESVTNAVLQDMFKKFGNIVSCKVATLEDGKSRGYGFVQFEQEDAAHAAIQTL- 172 Query: 294 NST 302 NST Sbjct: 173 NST 175 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.5 bits (73), Expect = 0.11 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 8/75 (10%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-NR-------CGFVHMQTEEQAAAAI 281 + K+FVG+L + L LFE+ G V +++ NR GFV M + ++A A+ Sbjct: 149 EAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAV 208 Query: 282 RALHNSTFNGGVISV 326 + NG +++V Sbjct: 209 EKFNRYDLNGRLLTV 223 Score = 29.9 bits (64), Expect = 1.3 Identities = 23/76 (30%), Positives = 31/76 (40%), Gaps = 8/76 (10%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 278 P +V+VG+LP L +LF G V E ++ GFV M ++ A Sbjct: 242 PAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEA 301 Query: 279 IRALHNSTFNGGVISV 326 I AL G I V Sbjct: 302 ISALDGQNLEGRAIRV 317 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 33.5 bits (73), Expect = 0.11 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 7/72 (9%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM------NR-CGFVHMQTEEQAAAAIRAL 290 K+FV +LP D+ +LF + G V +I+ NR FV M + E+A AAI Sbjct: 96 KLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQKDGKNRGFAFVTMASGEEAQAAIDKF 155 Query: 291 HNSTFNGGVISV 326 +G +ISV Sbjct: 156 DTFQVSGRIISV 167 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 33.1 bits (72), Expect = 0.14 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 287 + FVG L + EDL++ F +FG V + I+N GFV + E+ AI Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 288 LHNSTFNGG 314 ++ S GG Sbjct: 67 MNGSGGGGG 75 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 33.1 bits (72), Expect = 0.14 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 8/75 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIR 284 T+V+VG+L + + LR+ F +G V + +M GFV + +A AA+ Sbjct: 3 TRVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVS 62 Query: 285 ALHNSTFNGGVISVE 329 + NG +SV+ Sbjct: 63 GMDGKELNGRRVSVK 77 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 33.1 bits (72), Expect = 0.14 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG LP D + FE+FG T+ +M Sbjct: 109 KIFVGGLPSSVTESDFKTYFEQFGTTTDVVVM 140 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 33.1 bits (72), Expect = 0.14 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG LP D + FE+FG T+ +M Sbjct: 109 KIFVGGLPSSVTESDFKTYFEQFGTTTDVVVM 140 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L + +++R+ FE+FG + E I+ Sbjct: 17 TKVFVGGLAWETPTDEMRRYFEQFGEILEAVII 49 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L + +++R+ FE+FG + E I+ Sbjct: 17 TKVFVGGLAWETPTDEMRRYFEQFGEILEAVII 49 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 32.7 bits (71), Expect = 0.19 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN 230 K+FVG L + E+ + FERFG T+ +M+ Sbjct: 121 KIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMH 153 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTE 215 K+FVG + + + E L++ F R+G V E Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAVLE 34 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 32.3 bits (70), Expect = 0.25 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNSTFN 308 +FVG L EDL + F FG V I CGFV + A AI L+ + Sbjct: 329 IFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIG 388 Query: 309 GGVI 320 + Sbjct: 389 KNTV 392 >At1g43680.1 68414.m05018 hypothetical protein Length = 247 Score = 32.3 bits (70), Expect = 0.25 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -2 Query: 238 PHRFIISHSVTTPKRSNSFLRSSGLEPCGRLPTNTF 131 PHRF S + +TP S SFL +SG P R PT F Sbjct: 174 PHRFSSSSNSSTPIASASFLAASGWRPTTR-PTYEF 208 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 31.9 bits (69), Expect = 0.33 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG LP E+ + F++FG + + +M Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVM 142 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 31.9 bits (69), Expect = 0.33 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG LP E+ + F++FG + + +M Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVM 142 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 31.9 bits (69), Expect = 0.33 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG LP E+ + F++FG + + +M Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVM 142 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 31.9 bits (69), Expect = 0.33 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 8/71 (11%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVV--------TECDIMNRCGFVHMQTEEQAAAAIR 284 TK++VG LP ++ E L F+RFG + E D GFV + E A A + Sbjct: 13 TKIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACK 72 Query: 285 ALHNSTFNGGV 317 N T G + Sbjct: 73 D-PNPTIEGRI 82 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 31.9 bits (69), Expect = 0.33 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 8/69 (11%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIR 284 ++V++G +P + DL+ G VTE IM FV ++++ AA AI Sbjct: 92 SEVYLGGIPTDATEGDLKGFCGSIGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAID 151 Query: 285 ALHNSTFNG 311 L+N+ F G Sbjct: 152 TLNNTDFRG 160 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 31.9 bits (69), Expect = 0.33 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 8/78 (10%) Frame = +3 Query: 120 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDI-MNRCG-------FVHMQTEEQAAA 275 V K+F+ L + + LR FE FG + E I M++ F+ TEE A Sbjct: 279 VKTKKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEAAGT 338 Query: 276 AIRALHNSTFNGGVISVE 329 A++ ++ NG +I V+ Sbjct: 339 ALKEMNGKIINGWMIVVD 356 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 31.9 bits (69), Expect = 0.33 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAI 281 Q +FV L + E+L+ FE +G +TEC ++ GFV +T + A AA+ Sbjct: 162 QRNIFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAAL 221 Query: 282 RALHNSTFN 308 + +N Sbjct: 222 KNPEKRMYN 230 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L ++ E LR+ FE++G + E ++ Sbjct: 24 TKVFVGGLAWETQSETLRQHFEQYGEILEAVVI 56 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L + E ++K FE+FG + E ++ Sbjct: 13 TKVFVGGLAWETHKETMKKHFEQFGEILEAVVI 45 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L + E ++K FE+FG + E ++ Sbjct: 13 TKVFVGGLAWETHKETMKKHFEQFGEILEAVVI 45 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L + E ++K FE+FG + E ++ Sbjct: 13 TKVFVGGLAWETHKETMKKHFEQFGEILEAVVI 45 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 31.5 bits (68), Expect = 0.44 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L + +++R+ F++FG + E I+ Sbjct: 17 TKVFVGGLAWETPTDEMRRYFDQFGEILEAVII 49 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 31.1 bits (67), Expect = 0.58 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR------CGFVHMQTEEQAAAAIRALHN 296 ++V +L L ++F FG + C ++ GFV TE+ A +A ALH Sbjct: 114 LYVKNLDSSITSSCLERMFCPFGSILSCKVVEENGQSKGFGFVQFDTEQSAVSARSALHG 173 Query: 297 STFNG 311 S G Sbjct: 174 SMVYG 178 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 31.1 bits (67), Expect = 0.58 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTEC----DIMNRC---GFVHMQTEEQAAAAIRALH 293 VF+ +L + L + F FG + C D++ R GFV + EE A AAI L+ Sbjct: 134 VFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSKGYGFVQFEKEETAQAAIDKLN 193 Query: 294 NSTFN 308 N Sbjct: 194 GMLLN 198 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 420 PVRHAPPPRDAPYMRDRPGPVRGYERGPPAAPY 518 PV H+PPP Y+ P P + PP PY Sbjct: 388 PVYHSPPPPKEKYVYKSPPPPPVHHYSPPHHPY 420 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Frame = +3 Query: 420 PVRHAPPPRDAPYM-RDRPGPVRGYERGP---PAAPYDERYAY 536 PV H+PPP Y+ + P PV+ Y P P E+Y Y Sbjct: 360 PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVY 402 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 30.7 bits (66), Expect = 0.77 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 8/77 (10%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRC--------GFVHMQTEEQAAAA 278 P +FVG L + + LR++ ++G + ++ GFV +TE++ A Sbjct: 62 PYCTLFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRA 121 Query: 279 IRALHNSTFNGGVISVE 329 H+S +G I V+ Sbjct: 122 YEDAHHSLIDGREIIVD 138 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 P +FV L ++ EDL +F RFG V D++ Sbjct: 241 PDNVLFVCKLNPVTEDEDLHTIFSRFGTVVSADVI 275 >At1g31550.1 68414.m03871 GDSL-motif lipase, putative similar to lipase [Arabidopsis thaliana] GI:1145627; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 391 Score = 30.3 bits (65), Expect = 1.0 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +1 Query: 286 RFTTRHLTAA---SYPWSAVASKNAGSVGAVAVDEVPCAVAWSG 408 RF RHL+A P++ S++ GSVG A + VAW G Sbjct: 300 RFINRHLSACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDG 343 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L ++ E LR+ F+++G + E ++ Sbjct: 24 TKVFVGGLAWETQSETLRRHFDQYGDILEAVVI 56 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIR 284 + +FV L+K+F FG VT I+ G+V ++E A +A+ Sbjct: 77 SSLFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVE 136 Query: 285 ALHNSTFNGGVISVE 329 A++ F+G I V+ Sbjct: 137 AMNGKFFDGRFILVK 151 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 29.9 bits (64), Expect = 1.3 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 8/72 (11%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDI--------MNRCGFVHMQTEEQAAAAIRAL 290 + V ++P +PE+LR+ FERFG V + I FV A A R++ Sbjct: 49 LLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSM 108 Query: 291 HNSTFNGGVISV 326 + +F G I+V Sbjct: 109 NRRSFAGREITV 120 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 8/77 (10%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 278 P+ + F+G L + LR FE++G + E ++ GF+ ++ A Sbjct: 5 PEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEA 64 Query: 279 IRALHNSTFNGGVISVE 329 I A++ +G I+V+ Sbjct: 65 IAAMNGMDLDGRTITVD 81 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRALH 293 ++V +L E LR+LF FG +T C +M GFV +A+ + ++ Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDPSGTSKGSGFVAFSAASEASRVLNEMN 389 Query: 294 NSTFNG 311 G Sbjct: 390 GKMVGG 395 Score = 27.1 bits (57), Expect = 9.5 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 7/71 (9%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTEC----DIMNRC---GFVHMQTEEQAAAAIRALH 293 +FV +L + + L + F G + C D M + GFV TE+ A AI L+ Sbjct: 136 LFVKNLDKSVDNKTLHEAFSGCGTIVSCKVATDHMGQSRGYGFVQFDTEDSAKNAIEKLN 195 Query: 294 NSTFNGGVISV 326 N I V Sbjct: 196 GKVLNDKQIFV 206 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L + LR FE+FG + E ++ Sbjct: 7 TKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVI 39 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 TKVFVG L + LR FE+FG + E ++ Sbjct: 7 TKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVI 39 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 +TK++V LP ++ E L FERFG + ++ Sbjct: 8 ETKIYVAGLPWITRTEGLISYFERFGEIVYAKVV 41 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG L + +K F +FG++T+ +M Sbjct: 34 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVM 65 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG L + +K F +FG++T+ +M Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVM 138 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG L + +K F +FG++T+ +M Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVM 138 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 29.5 bits (63), Expect = 1.8 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG LP + + F++FG + + +M Sbjct: 123 KIFVGGLPSSITEAEFKNYFDQFGTIADVVVM 154 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 29.5 bits (63), Expect = 1.8 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 8/73 (10%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 287 +++VG+LP +L ++F G V + I+ GFV M + E+A A++ Sbjct: 117 RLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQM 176 Query: 288 LHNSTFNGGVISV 326 ++S G + V Sbjct: 177 FNSSQIGGRTVKV 189 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 29.1 bits (62), Expect = 2.4 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 6/75 (8%) Frame = +3 Query: 120 VPQTKVFVGSLPQGSKPEDLRKLFERFGVV----TECDIMNRCGFVHMQTEEQAAA--AI 281 +P + VG++ + +L+ LFE+FG + T C NR GF+ + + AA A Sbjct: 214 IPSRTLLVGNISSNVEDYELKVLFEQFGDIQALHTAC--KNR-GFIMVSYCDIRAAQNAA 270 Query: 282 RALHNSTFNGGVISV 326 RAL N G + + Sbjct: 271 RALQNKLLRGTKLDI 285 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAI 281 +T +++G LP + + L LF FG + ++ GFV + A A+ Sbjct: 479 ETNLYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAV 538 Query: 282 RALHNSTFNGGVISV 326 +A++ F G ++V Sbjct: 539 QAMNGYRFEGRTLAV 553 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAI 281 +T +++G LP + + L LF FG + ++ GFV + A A+ Sbjct: 479 ETNLYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAV 538 Query: 282 RALHNSTFNGGVISV 326 +A++ F G ++V Sbjct: 539 QAMNGYRFEGRTLAV 553 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 K+FVG +P ++ ++ F +FG + E IM Sbjct: 131 KIFVGGIPSSVDDDEFKEFFMQFGELKEHQIM 162 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 8/75 (10%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDI-MNRC-------GFVHMQTEEQAAAAIR 284 +K+F+G L + + L + F + G V E I M+R GFV + ++A A+ Sbjct: 34 SKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALM 93 Query: 285 ALHNSTFNGGVISVE 329 + NG I V+ Sbjct: 94 EFNGQQLNGRTIFVD 108 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 429 HAPPPRDAPYMRDRPGPVRGYERGPPAAP 515 H+PPP Y P P E PP AP Sbjct: 680 HSPPPSPVHYSSPPPPPSAPCEESPPPAP 708 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 9/75 (12%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVVTEC----DIM--NRCG--FVHMQTEEQAAAAIRA 287 K++V + + + D+R++FE++G VTE D M R F+ + E+ AAI A Sbjct: 111 KLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTGERAAYCFIKYKKVEEGNAAIAA 170 Query: 288 L-HNSTFNGGVISVE 329 L TF G ++ V+ Sbjct: 171 LTEQFTFPGEMLPVK 185 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 8/75 (10%) Frame = +3 Query: 120 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAA 275 + Q +FV + E+L+ FE +G + EC ++ GFV +T + A Sbjct: 405 IAQRNIFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGARE 464 Query: 276 AIRALHNSTFNGGVI 320 A++ +N V+ Sbjct: 465 ALKRPEKRMYNRIVV 479 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 5/70 (7%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 299 V+VG+LP + ++ LF ++G V + D+ FV A AI Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGY 68 Query: 300 TFNGGVISVE 329 F+G + VE Sbjct: 69 DFDGHRLRVE 78 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 5/70 (7%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 299 V+VG+LP + ++ LF ++G V + D+ FV A AI Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGY 68 Query: 300 TFNGGVISVE 329 F+G + VE Sbjct: 69 DFDGHRLRVE 78 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 5/70 (7%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 299 V+VG+LP + ++ LF ++G V + D+ FV A AI Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGY 68 Query: 300 TFNGGVISVE 329 F+G + VE Sbjct: 69 DFDGHRLRVE 78 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 28.7 bits (61), Expect = 3.1 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 8/76 (10%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 278 P K+FVG+L L +LFE G V +++ GFV M T + AA Sbjct: 97 PDLKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAA 156 Query: 279 IRALHNSTFNGGVISV 326 + + F G + V Sbjct: 157 AQQFNGYEFEGRPLRV 172 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 28.7 bits (61), Expect = 3.1 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 8/76 (10%) Frame = +3 Query: 123 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 278 P K+FVG+L L +LFE G V +++ GFV M T + AA Sbjct: 97 PDLKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAA 156 Query: 279 IRALHNSTFNGGVISV 326 + + F G + V Sbjct: 157 AQQFNGYEFEGRPLRV 172 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 120 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 V K+FV LP + E L +FE +G + EC ++ Sbjct: 101 VTHRKIFVYGLPWETTRETLVGVFEGYGEIEECTVV 136 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 120 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 227 V K+FV LP + E L +FE +G + EC ++ Sbjct: 101 VTHRKIFVYGLPWETTRETLVGVFEGYGEIEECTVV 136 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVV 209 +++VG+L +DLRK+FE FG V Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSV 311 >At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 459 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 7/58 (12%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR------C-GFVHMQTEEQAAAAIRA 287 ++V +LP S P L ++F+ FG + I R C GFV +T +A+ A Sbjct: 295 IYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNKQGFCFGFVEFETSSGKQSALEA 352 >At5g22930.1 68418.m02681 hypothetical protein Length = 248 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 126 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR-CG 239 QT + G LPQ P K FE V +C I+N CG Sbjct: 186 QTLLLAGPLPQWRHPPPPLKSFEIPPVTVQCPIVNNGCG 224 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 5/70 (7%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 299 ++VG+LP + ++ LF ++G V + D+ FV + A AI Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGY 68 Query: 300 TFNGGVISVE 329 F+G + VE Sbjct: 69 DFDGHHLRVE 78 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 5/70 (7%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 299 ++VG+LP + ++ LF ++G V + D+ FV + A AI Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGY 68 Query: 300 TFNGGVISVE 329 F+G + VE Sbjct: 69 DFDGHHLRVE 78 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 120 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR 233 V K++VG +P S +++R F GV+ + D R Sbjct: 158 VVPNKLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKMR 195 >At2g40475.1 68415.m04995 expressed protein Length = 193 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/44 (25%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +1 Query: 229 TGAGSCICRQRNKRQQQFAR-FTTRHLTAASYPWSAVASKNAGS 357 + +G+ + + R +Q +F + +RH++ S+ WS+ +S ++ S Sbjct: 75 SSSGNKLSKARTIKQTRFVKTLLSRHVSRPSFSWSSASSSSSSS 118 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTE 215 T + V +L + EDLRK FE+FG V + Sbjct: 36 TSLLVRNLRHDCRQEDLRKSFEQFGPVKD 64 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 540 RRTHSAHHRAPPADRVRSRAPDPA 469 RR++S R+PP R RS +P PA Sbjct: 143 RRSYSPRARSPPPPRRRSPSPPPA 166 >At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 460 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 8/59 (13%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR-------C-GFVHMQTEEQAAAAIRA 287 ++V +LP S P L ++F+ FG + I R C GFV +T +A+ A Sbjct: 295 IYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNKQQGFCFGFVEFETSSGKQSALEA 353 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 420 PVRHAPPPRDAPYMRDRPGPVRGYERGPPAAPY 518 P H PPP +P + P P + PP +PY Sbjct: 40 PPHHPPPPHFSPPHQPPPSPY-PHPHPPPPSPY 71 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 27.5 bits (58), Expect = 7.2 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +3 Query: 171 EDLRKLFERFGVVTECDI-MNRCGFVHM--QTEEQAAAAIRALHNSTFNGGVIS 323 +D+ ++G V + N GFV++ Q+ E AAAA RA+H F +IS Sbjct: 459 DDVADECSKYGPVNHIYVDKNSAGFVYLRFQSVEAAAAAQRAMHMRWFAQKMIS 512 >At1g13730.1 68414.m01612 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) Length = 428 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 135 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR 233 +FV +L + PE L + F+ FG +T+ I R Sbjct: 279 IFVANLLMDATPEQLNETFKGFGAITKDGIQVR 311 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 132 KVFVGSLPQGSKPEDLRKLFERFGVV 209 K+FVG+LP K + + F +FG + Sbjct: 166 KIFVGNLPTWIKKPEFEEFFRQFGPI 191 >At4g30250.1 68417.m04301 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 512 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 253 RQRNKRQQQFARFTTRHLTAASYPWSAVASKNAGSVGAVAVD 378 R+RN+ + + L A S+PW +V K+ + +A+D Sbjct: 168 RRRNEERLLYTNSRGVSLDARSHPWDSVRFKHPSTFDTLAMD 209 >At1g27650.1 68414.m03379 U2 snRNP auxiliary factor small subunit, putative Strong similarity to gb|Y18349 U2 snRNP auxiliary factor, small subunit from Oryza sativa. ESTs gb|AA586295 and gb|AA597332 come from this gene Length = 296 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 10/52 (19%) Frame = +3 Query: 186 LFERFGVVTECDIMNRCG----------FVHMQTEEQAAAAIRALHNSTFNG 311 LFE G E + +N C +V + E+QAAAA++AL ++G Sbjct: 85 LFEELGKFGEIESLNICDNLADHMIGNVYVQFKEEDQAAAALQALQGRFYSG 136 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR---CGFVHMQTEEQAAAAIRAL 290 T+V+VG+L +L F+ FGV+ + R F+ E A AI AL Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISAL 58 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +3 Query: 129 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR---CGFVHMQTEEQAAAAIRAL 290 T+V+VG+L +L F+ FGV+ + R F+ E A AI AL Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISAL 58 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,962,781 Number of Sequences: 28952 Number of extensions: 237295 Number of successful extensions: 1117 Number of sequences better than 10.0: 128 Number of HSP's better than 10.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1081 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -