BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h06r (785 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 160 2e-41 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 71 2e-14 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 56 4e-10 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 26 0.35 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 25 0.60 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 24 1.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 4.3 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 22 5.6 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 22 5.6 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 22 5.6 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 160 bits (388), Expect = 2e-41 Identities = 75/131 (57%), Positives = 96/131 (73%) Frame = -1 Query: 716 EFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTE 537 +F+GK+YK+ SSENFD+FMK +GVG++TRK ++V+P VEL ++ Y L T+S FK TE Sbjct: 3 DFLGKRYKLYSSENFDDFMKALGVGIMTRKVGSSVSPVVELTENNGLYTLKTTSPFKNTE 62 Query: 536 MKFKPGEEFEEDRADGAKVKSVCTFEGNTLKQVQKAPDGLEVTYVREFGPEEMKAVMTAK 357 +KFK GEEFEE+ DG KVKSVCT +GN L QVQK + T REF EMKA+M Sbjct: 63 IKFKLGEEFEEETVDGRKVKSVCTLDGNKLIQVQKGEK--QTTIEREFSSTEMKAIMKVD 120 Query: 356 DVTCTRVYKVQ 324 D+ CTRVYK+Q Sbjct: 121 DIICTRVYKIQ 131 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 70.5 bits (165), Expect = 2e-14 Identities = 48/134 (35%), Positives = 67/134 (50%), Gaps = 4/134 (2%) Frame = -1 Query: 719 MEFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTT 540 ++F GK ++ S NF+EF K +G + P+ EL K+GDE+ +SS T Sbjct: 2 VQFEGK-FQFVSQNNFEEFAKVLGDQNLVNTVLQP-RPSFELSKNGDEWTFTSSSGDNTY 59 Query: 539 EMKFKPGEEFEE--DRADGAKVKSVCTFEGNTLKQVQKAPDGLEVTYVREFGPEEMKA-V 369 FK FEE K ++V + EGNT K + D L+VT + EF E+ + Sbjct: 60 TKTFKMNVPFEETLPSLPDRKFQTVTSIEGNTFKTETQVNDSLKVTRLYEFSDNELLVHI 119 Query: 368 MTAK-DVTCTRVYK 330 T K DV TRVYK Sbjct: 120 STNKSDVKATRVYK 133 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 56.0 bits (129), Expect = 4e-10 Identities = 36/105 (34%), Positives = 51/105 (48%), Gaps = 2/105 (1%) Frame = -1 Query: 716 EFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTE 537 +F GK ++ S NF+EF K +G + P+ EL K+GDE+ +SS T Sbjct: 1 QFEGK-FQFVSQNNFEEFAKVLGDQNLVNTVLQP-RPSFELSKNGDEWTFTSSSGDNTYT 58 Query: 536 MKFKPGEEFEE--DRADGAKVKSVCTFEGNTLKQVQKAPDGLEVT 408 FK FEE K ++V + EGNT K + D L+VT Sbjct: 59 KTFKMNVPFEETLPSLPDRKFQTVTSIEGNTFKTETQVNDSLKVT 103 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 26.2 bits (55), Expect = 0.35 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 98 AHAREAFIVFKNTFIVYIKPKLTF 27 +H AFI + F +Y++P TF Sbjct: 121 SHPTAAFISYGTLFFIYVQPSATF 144 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 25.4 bits (53), Expect = 0.60 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 98 AHAREAFIVFKNTFIVYIKPKLTF 27 +H AFI + F +Y+ P TF Sbjct: 122 SHPTAAFISYGTLFFIYVHPSATF 145 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 24.2 bits (50), Expect = 1.4 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = +3 Query: 270 GCS*IGGTDSRPRSRVLLLDLVDSGASHVLSCHHSFHLLRAEFPDVSDFKTV 425 GC RSR+ L D G S S + L+R E D D +T+ Sbjct: 13 GCDEQTSRGDNDRSRIARLGRDDGGKSRQSSFEVTSLLMREETEDAEDTQTL 64 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 4.3 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +1 Query: 532 FISVVLKVEEVTKLYSSPSLRSSTV 606 FIS+++ +E+ + +SP L + T+ Sbjct: 9 FISLIILNDEIYNIIASPQLNNPTL 33 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 470 CTFEGNTLKQVQKAPDGL 417 CT EGN LK+V PD L Sbjct: 57 CTAEGNELKRV--LPDAL 72 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 470 CTFEGNTLKQVQKAPDGL 417 CT EGN LK+V PD L Sbjct: 57 CTAEGNELKRV--LPDAL 72 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 470 CTFEGNTLKQVQKAPDGL 417 CT EGN LK+V PD L Sbjct: 57 CTAEGNELKRV--LPDAL 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,616 Number of Sequences: 438 Number of extensions: 4166 Number of successful extensions: 18 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -