BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h05f (588 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0197 - 15522167-15523524,15525416-15525683 30 1.2 05_07_0350 - 29457444-29457871,29458786-29461456 29 3.6 05_07_0195 - 28331445-28331641,28331841-28331934,28332019-283320... 29 3.6 07_01_1113 - 10292781-10293299 28 4.8 05_01_0495 - 4136871-4136906,4137043-4137171,4137545-4137694,413... 28 4.8 03_06_0309 - 33039006-33039184,33039753-33039912 28 4.8 02_03_0109 - 15333228-15334793,15335255-15335392,15335496-153357... 28 4.8 03_01_0056 - 471338-471919,472013-472213 28 6.3 11_06_0099 + 20070925-20073867 27 8.4 09_04_0717 + 19706160-19706327,19707036-19707157,19707408-197075... 27 8.4 08_01_1019 - 10290820-10291393,10293978-10294348 27 8.4 >09_04_0197 - 15522167-15523524,15525416-15525683 Length = 541 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +1 Query: 454 GWTRKLKRPRTNGTKVGTKP 513 G++++L RPR+NGT + TKP Sbjct: 416 GFSQRLTRPRSNGTYLSTKP 435 >05_07_0350 - 29457444-29457871,29458786-29461456 Length = 1032 Score = 28.7 bits (61), Expect = 3.6 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = -3 Query: 265 GIKPSLTLPGSPLTGRAKVFWSCVATSEAEPRATSAVHAVCLL--APERKATRDNIIYRI 92 G P T PGS GRA V W A A AV A ER+ R R Sbjct: 637 GPAPGTTTPGSGGDGRAPVMWLAAALGLLACSVAFAAAAVATTRSAIERR-RRSGWQMRA 695 Query: 91 FYKLFPKCED 62 F K+ CED Sbjct: 696 FQKVRFGCED 705 >05_07_0195 - 28331445-28331641,28331841-28331934,28332019-28332099, 28332186-28332234,28332334-28332419,28332513-28332740, 28332819-28332857,28332958-28333047,28333207-28333269, 28333371-28333449,28333539-28333585,28333668-28333730, 28333814-28333864,28333977-28334060,28334162-28334226, 28334559-28334676,28334775-28334825,28335228-28335314, 28335633-28335712,28336676-28336793 Length = 589 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 326 CGSGNIPVQQGNLCNGARILLRTVTAGH 409 CG + PV++GN CNGA + GH Sbjct: 542 CGVVSSPVRRGNYCNGATKQQKLYQNGH 569 >07_01_1113 - 10292781-10293299 Length = 172 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = +3 Query: 177 SASDVATHDQKTFARPVRGEPGKVRLGFIPEEWFQFFHSKTGVTGPYTFGVGLA 338 S+ D AT + PG +RL + + + H + GP+ G+GL+ Sbjct: 91 SSVDAATKGNPPRSARTTSAPGSLRLPEVAQRVVELLHHRHWWFGPWALGLGLS 144 >05_01_0495 - 4136871-4136906,4137043-4137171,4137545-4137694, 4137782-4137847,4138124-4138168,4139022-4139102, 4139202-4139283,4139571-4139642,4140473-4140573, 4140690-4140806,4140929-4141249 Length = 399 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 260 YS*RMVPILPLENWCDGS 313 Y+ RM PI+P+ENW GS Sbjct: 213 YNPRMDPIIPVENWRKGS 230 >03_06_0309 - 33039006-33039184,33039753-33039912 Length = 112 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 Query: 483 SRSLQLPCPTKQPILVRISREPHTP*PAVTVRSNIR 376 +RS+ LP P +P + PH P AV R +R Sbjct: 11 ARSMALPIPLARPPPLATVARPHPPQDAVQARDGVR 46 >02_03_0109 - 15333228-15334793,15335255-15335392,15335496-15335771, 15336357-15336422,15338140-15338487 Length = 797 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 129 SGASKQTACTALVARGSASDVATHDQKTFAR 221 + A K AC ALV+RG A+D + + AR Sbjct: 630 AAAGKLEACRALVSRGGAADAGSETALSVAR 660 >03_01_0056 - 471338-471919,472013-472213 Length = 260 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 282 FFHSKTGVTGPYTFGVGLATYLCSKEIYVMEHE 380 +F + V YT GV A YL + E+Y +H+ Sbjct: 47 YFGASIKVPSGYTAGVNTAFYLSNNELYPGQHD 79 >11_06_0099 + 20070925-20073867 Length = 980 Score = 27.5 bits (58), Expect = 8.4 Identities = 15/58 (25%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +3 Query: 342 YLCSKEIYVMEHEYYSGLSLLVMVYVAHVKFGPKLAAWLDKEVEATENEWNE-GRNQT 512 YLC + ++ + L Y A + GP + WL +V+ N+ G N T Sbjct: 445 YLCYNHLNIVMDPQWLPPFKLEKSYFASITMGPSFSRWLQSQVDIVALAMNDAGINDT 502 >09_04_0717 + 19706160-19706327,19707036-19707157,19707408-19707510, 19707644-19707734,19707960-19708132,19708534-19708622, 19708995-19709085,19709272-19709361,19709807-19709854, 19710033-19710104,19710181-19710274,19710350-19710494, 19710809-19710951,19711601-19711751,19712276-19712449, 19712799-19712874 Length = 609 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +3 Query: 243 KVRLGFIPEEWFQFFHSKTGVTGPYTFGVGLATYLCSKEIYVMEHEYYSGLSLL 404 + +L FIPE W Q + + Y +G L S ++ E SGL L Sbjct: 337 ETQLKFIPEAWSQIIECRRVLKWTYAYGYYLHNKAKSDFFVYLQGEAESGLERL 390 >08_01_1019 - 10290820-10291393,10293978-10294348 Length = 314 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = -2 Query: 350 AQVCCQTHTKSVRTRHTSFRVEELEPFFRNKAKSNFAWLTP 228 A CC+ + +R F +LEP F + W TP Sbjct: 44 AMACCRAWRDAAASRPALFAALDLEPAFASVGADAAEWWTP 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,075,482 Number of Sequences: 37544 Number of extensions: 400352 Number of successful extensions: 1281 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1281 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -