BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h04f (557 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces ... 27 2.5 SPAC6B12.11 |drc1|sld1|DNA replication protein Drc1|Schizosaccha... 26 3.3 SPAC1296.01c ||SPAC22F3.01|phosphoacetylglucosamine mutase |Schi... 25 5.7 SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein Rad50|Schizos... 25 5.7 SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces p... 25 7.5 SPBC2G2.14 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 10.0 >SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 26.6 bits (56), Expect = 2.5 Identities = 31/112 (27%), Positives = 48/112 (42%), Gaps = 7/112 (6%) Frame = +3 Query: 231 EYKLEGDVVKVKNVHIIDGVKKYIE---GTAKL-TDDANKAAKLTVTFKFGEISRDGSVQ 398 EY++EG +++ N IID + E G KL KA + T+T E D Q Sbjct: 600 EYRMEGQFLEIYNETIIDLLASGNEEEKGKKKLEIYHDTKAGRTTITNITSE-PLDTPEQ 658 Query: 399 V---LATDYNNYAIAYNCKYDDKKKSHQVFVWILSRNKKLEGDAKTAVDNFI 545 V L N ++A + +SH VF+ L+ + G+ + N I Sbjct: 659 VTWLLDQASKNRSVAATNANEHSSRSHSVFMLHLNGSNSTTGETCRSTLNLI 710 >SPAC6B12.11 |drc1|sld1|DNA replication protein Drc1|Schizosaccharomyces pombe|chr 1|||Manual Length = 337 Score = 26.2 bits (55), Expect = 3.3 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +1 Query: 316 SSPTTPIKPQS*QSLLSLEKYHAMDQFKSWRLTIITTPSLTTANTMTRKSL 468 SS P P ++ ++ S+RL + T+P+L N RKSL Sbjct: 147 SSTMIPTTPSKNPEPVAQHTPTVLETPSSYRLQVYTSPNLLRVNAPCRKSL 197 >SPAC1296.01c ||SPAC22F3.01|phosphoacetylglucosamine mutase |Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 25.4 bits (53), Expect = 5.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 474 LDETFSCHRICSCKRWRSYYSQSP 403 L E H+ C+ K W YS+ P Sbjct: 439 LVEVILAHKNCTLKEWNQLYSEIP 462 >SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein Rad50|Schizosaccharomyces pombe|chr 1|||Manual Length = 1290 Score = 25.4 bits (53), Expect = 5.7 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 141 NFNLTAYQGIWYEISKFPNESEKNGKCSSAEYKLEGDVVKVKNVHIIDGVKKY 299 N N +GI E+SK+ + KN + SS + K V+ + I+G+K + Sbjct: 376 NINEINEEGIMTEVSKYASLVNKNYEISSGKLKERQVAVRAR----IEGIKAH 424 >SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces pombe|chr 2|||Manual Length = 571 Score = 25.0 bits (52), Expect = 7.5 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +1 Query: 277 SSTASRSI*KGRPSSPTTPI--KPQS*QSLLSLEKY 378 +S SR I PSSP+TPI P+ + +LSL++Y Sbjct: 534 ASLPSRRIVYKPPSSPSTPISMNPRP-KGILSLQQY 568 >SPBC2G2.14 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 24.6 bits (51), Expect = 10.0 Identities = 12/45 (26%), Positives = 26/45 (57%) Frame = +3 Query: 378 SRDGSVQVLATDYNNYAIAYNCKYDDKKKSHQVFVWILSRNKKLE 512 S + +++ ++ D NN A +N +YD+ ++ F ++ R K +E Sbjct: 161 SLEANLKAISKDSNNKA--HNNRYDESSLTNPEFSILVERLKSIE 203 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,020,340 Number of Sequences: 5004 Number of extensions: 37774 Number of successful extensions: 112 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 233995432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -