BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h02r (725 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosa... 27 2.1 SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyce... 25 8.3 >SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 27.5 bits (58), Expect = 2.1 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -1 Query: 470 SYPEVCGKLINPNQQKGMRPHLRKVTDPSKRF 375 +Y VCGK +P+Q+K +R R++ P ++F Sbjct: 417 AYAAVCGKTRSPHQKKPLRVEFRQLR-PMQQF 447 >SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 459 Score = 25.4 bits (53), Expect = 8.3 Identities = 25/100 (25%), Positives = 38/100 (38%), Gaps = 7/100 (7%) Frame = -1 Query: 545 IAGVPPIHTDGPGEAGPYVKTEGL-------LSYPEVCGKLINPNQQKGMRPHLRKVTDP 387 I +P I + PG G EG+ LS + K P + + KV Sbjct: 111 IVSIPEIQLEIPGRLGQLTTIEGILSNVVDDLSKEQESRKESAPQLYDQINAFIEKVN-- 168 Query: 386 SKRFGTYAFRLPDDNGEGGIWVSYEDPDTAGQKAAYVKSK 267 S R G+ F + D+ G W+ + P G + + V K Sbjct: 169 SLRSGSVPFTITVDDITGNSWIEMK-PGRDGDRWSQVSYK 207 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,117,446 Number of Sequences: 5004 Number of extensions: 69671 Number of successful extensions: 200 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 199 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -