BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g24r (760 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 29 0.047 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 22 7.2 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 7.2 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 22 7.2 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 9.5 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 29.1 bits (62), Expect = 0.047 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 419 SLSTSVRGPEQLEEPVHHRVQPVLPAGPDPVDGGSQR 309 +L + R E L HHR+ P + DPV G ++ Sbjct: 52 TLYSGTRSSESLTAQAHHRLYPAFSSSCDPVPGNLEQ 88 Score = 25.8 bits (54), Expect = 0.44 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +2 Query: 203 DHVVQQTADGAPHEYGGGQQHLEHRVQRLQPRVYDAAVSRHPPGQDQREEQAEPYDVQ 376 DH Q+T P + QQ + + Q QP+ P Q Q+++Q +P Q Sbjct: 1494 DHSSQKTQQQQPQQQQQQQQQQQPQQQSQQPQQQQP----QPQQQQQQQQQQQPQQQQ 1547 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 271 LQVLLSTSILVGGAVGCLLD 212 + V+L+T L+ V CLLD Sbjct: 33 IDVVLNTERLLNAYVNCLLD 52 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.8 bits (44), Expect = 7.2 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -2 Query: 669 WAPRGWARR 643 W P GW RR Sbjct: 178 WTPHGWMRR 186 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 271 LQVLLSTSILVGGAVGCLLD 212 + V+L+T L+ V CLLD Sbjct: 33 IDVVLNTERLLNAYVNCLLD 52 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.4 bits (43), Expect = 9.5 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -1 Query: 535 GLMVLQ-GVVGKLGAVFIIIPQPVVGGLFCVMFGMISAFGLSALQYVDLNSSRNL 374 GL+ Q G GKL F +I ++ L ++ S FG+ L + S NL Sbjct: 251 GLVAGQFGAQGKLIVDFFMILNEIIMKLVGIIIMWYSPFGIMCLIAGKIMSINNL 305 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,403 Number of Sequences: 438 Number of extensions: 4255 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -