BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g23f (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 33 0.12 At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 31 0.82 At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family pr... 30 1.1 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 29 3.3 At5g63450.1 68418.m07965 cytochrome P450, putative 28 5.8 At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identica... 27 7.7 At3g48520.1 68416.m05296 cytochrome P450 family protein similar ... 27 7.7 At1g59453.1 68414.m06679 transcription factor-related weak simil... 27 7.7 At1g59077.1 68414.m06670 hypothetical protein 27 7.7 At1g58766.1 68414.m06659 hypothetical protein 27 7.7 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 33.5 bits (73), Expect = 0.12 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +3 Query: 27 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKK 206 +D + P+ +I+ + V +L S +P D+L++ L D DSA +K E K Sbjct: 154 VDLADLLPSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKM 213 Query: 207 SEVITNV 227 + N+ Sbjct: 214 GSIAPNL 220 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 30.7 bits (66), Expect = 0.82 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 298 PRTSSGIVSQLSSDLSSPKTRLSLCTSATVS 390 PR +G S L SDL P+T + CTS V+ Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTSVGVA 201 >At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family protein similar to CHY1 [gi:8572760]; contains Pfam profile PF00388 enoyl-CoA hydratase/isomerase family protein Length = 387 Score = 30.3 bits (65), Expect = 1.1 Identities = 34/118 (28%), Positives = 54/118 (45%), Gaps = 4/118 (3%) Frame = +3 Query: 207 SEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRL---IFAENAIKLMYK 377 +E IT V+ L R++ ++ Q +G K + DC EFRL I + MY Sbjct: 263 NEWITPVIKGLKRSSPTG-LKIVLQSIREGRKQTLSDCLKKEFRLTLNILRKTISPDMY- 320 Query: 378 RDGL-ALTLSNDVQGDDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTERNQY 548 +G+ ALT+ D PA D D +K L+E++ + +I TE N++ Sbjct: 321 -EGIRALTIDKD-NSPKWNPATLDEVDDEKINSVFK---LFEDDDIELQIPETEENRW 373 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = +1 Query: 10 LGNTQDSTLQR*SPL*LFYVFSWHLCMLQIPTSLTTFWRSSFTIASSSPITTV 168 LG +T+Q + + +W + +L +P ++ FW + +ASS + + Sbjct: 1065 LGGFASTTIQLCGIVAVMTNVTWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 >At5g63450.1 68418.m07965 cytochrome P450, putative Length = 510 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +3 Query: 447 GKDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVG 566 G+D TS ++W L +N+ V KIL+ RN+ LG+G Sbjct: 306 GRDTTSAAMTWLFWLLSQNDDVETKILDELRNKG-SLGLG 344 >At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identical to Anthocyaninless2 [Arabidopsis thaliana] GI:5702094 Length = 802 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 528 NTERNQYLVLGVGTNWNGDHMAF 596 N N L L VGTN NG H AF Sbjct: 270 NHHYNSSLELAVGTNNNGGHFAF 292 >At3g48520.1 68416.m05296 cytochrome P450 family protein similar to Cytochrome P450 94A1 (P450-dependent fatty acid omega-hydroxylase) (SP:O81117) {Vicia sativa}; contains Pfam profile: PF00067 cytochrome P450 Length = 506 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 447 GKDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVG 566 G+D TS ++W L EN+ V KIL E + + LG+G Sbjct: 304 GRDTTSAAMTWLFWLLTENDDVERKILE-EVDPLVSLGLG 342 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 120 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 227 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 1545 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 1581 >At1g59077.1 68414.m06670 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 120 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 227 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g58766.1 68414.m06659 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 120 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 227 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,257,917 Number of Sequences: 28952 Number of extensions: 230917 Number of successful extensions: 928 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -