BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g22f (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 27 0.11 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 0.56 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 25 0.56 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 24 0.98 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.3 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.3 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 3.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 6.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 6.9 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 9.2 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 9.2 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 27.5 bits (58), Expect = 0.11 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 85 SRYLLEVTCKALQILGQTYKCQIQSDRSTPALYEPYQPA 201 S Y + T Q QT + Q+ DR++P Y Y PA Sbjct: 394 SLYPMATTSPQSQSTIQTLRPQVSPDRTSPMEYRLYNPA 432 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 25.0 bits (52), Expect = 0.56 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 397 SAGSSCSDWQEDSTGTRSAKCS 462 SAG+SC E TRSA C+ Sbjct: 26 SAGTSCKWLSEGGNDTRSADCT 47 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 25.0 bits (52), Expect = 0.56 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +1 Query: 316 DDGGCSSCYRKSSCTHFGCWRRNSYF*SAGSSCSDWQEDSTGTRSAKCS 462 +DGGCSS S+ + +++N Y SS S + + + C+ Sbjct: 924 NDGGCSSLVDVSTPVNKKVYKQNDYIVDESSSSSFYSSFLYKSSESSCN 972 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 315 FGILYSLTSFVTVPTTTA 262 FG +Y L ++ VPTTTA Sbjct: 367 FGSIYFLGNYSLVPTTTA 384 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -2 Query: 330 AATVIFGILYSLTSFVTVPTTTAIKPS 250 ++ VIFG+L+ L SF+ T T ++P+ Sbjct: 14 SSCVIFGVLFVLFSFLR--TRTKLQPT 38 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -2 Query: 330 AATVIFGILYSLTSFVTVPTTTAIKPS 250 ++ VIFG+L+ L SF+ T T ++P+ Sbjct: 14 SSCVIFGVLFVLFSFLR--TRTKLQPT 38 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -2 Query: 225 AKRDTEIGGRLIRLIKSRRRTI 160 AK+ T IGG+ + ++KS +++ Sbjct: 889 AKKATNIGGKPVAVVKSSAQSL 910 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 6.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 281 VTNDVRLYKIPKMTVAALHVTEKARARILAAGGEIL 388 VT R+ + VAA T + ARI + GG ++ Sbjct: 1289 VTGSTRVGEGQSSKVAAQVPTNRVPARITSFGGHVV 1324 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 6.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 281 VTNDVRLYKIPKMTVAALHVTEKARARILAAGGEIL 388 VT R+ + VAA T + ARI + GG ++ Sbjct: 1285 VTGSTRVGEGQSSKVAAQVPTNRVPARITSFGGHVV 1320 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 454 SLTLYQYCLLASRS 413 S+T Y YCLL + S Sbjct: 69 SITCYMYCLLEAFS 82 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 454 SLTLYQYCLLASRS 413 S+T Y YCLL + S Sbjct: 69 SITCYMYCLLEAFS 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,416 Number of Sequences: 438 Number of extensions: 3837 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -