BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g21r (741 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071183-1|AAL48805.1| 190|Drosophila melanogaster RE23430p pro... 29 8.8 AE014298-3147|AAN09679.1| 190|Drosophila melanogaster CG12565-P... 29 8.8 AE014298-3146|AAF50810.2| 190|Drosophila melanogaster CG12565-P... 29 8.8 >AY071183-1|AAL48805.1| 190|Drosophila melanogaster RE23430p protein. Length = 190 Score = 28.7 bits (61), Expect = 8.8 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 256 ISLSYFFPLRLLKVFFISIVLLCFCINRFLFAL-CYLSRIFC 134 + S P RL+ V F+S LL FC F L C+ C Sbjct: 148 VEFSTSVPFRLVPVRFVSFQLLSFCPRSLSFCLICHFKCTIC 189 >AE014298-3147|AAN09679.1| 190|Drosophila melanogaster CG12565-PB, isoform B protein. Length = 190 Score = 28.7 bits (61), Expect = 8.8 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 256 ISLSYFFPLRLLKVFFISIVLLCFCINRFLFAL-CYLSRIFC 134 + S P RL+ V F+S LL FC F L C+ C Sbjct: 148 VEFSTSVPFRLVPVRFVSFQLLSFCPRSLSFCLICHFKCTIC 189 >AE014298-3146|AAF50810.2| 190|Drosophila melanogaster CG12565-PA, isoform A protein. Length = 190 Score = 28.7 bits (61), Expect = 8.8 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 256 ISLSYFFPLRLLKVFFISIVLLCFCINRFLFAL-CYLSRIFC 134 + S P RL+ V F+S LL FC F L C+ C Sbjct: 148 VEFSTSVPFRLVPVRFVSFQLLSFCPRSLSFCLICHFKCTIC 189 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,397,630 Number of Sequences: 53049 Number of extensions: 418631 Number of successful extensions: 881 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3355404063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -