BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g21f (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36720.1 68417.m05210 abscisic acid-responsive HVA22 family p... 99 3e-21 At4g24960.1 68417.m03576 ABA-responsive protein (HVA22d) identic... 85 3e-17 At5g50720.1 68418.m06285 ABA-responsive protein (HVA22e) identic... 81 6e-16 At1g69700.1 68414.m08021 ABA-responsive protein (HVA22c) identic... 79 3e-15 At2g42820.1 68415.m05301 abscisic acid-responsive HVA22 family p... 76 2e-14 At1g74520.1 68414.m08633 ABA-responsive protein (HVA22a) identic... 73 1e-13 At5g42560.1 68418.m05180 abscisic acid-responsive HVA22 family p... 69 3e-12 At1g75700.1 68414.m08794 abscisic acid-responsive HVA22 family p... 69 3e-12 At2g36020.1 68415.m04423 abscisic acid-responsive HVA22 family p... 69 4e-12 At5g62490.1 68418.m07843 ABA-responsive protein (HVA22b) identic... 68 5e-12 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 67 8e-12 At5g38150.1 68418.m04598 expressed protein 30 1.2 At2g18950.1 68415.m02212 homogentisate phytylprenyltransferase f... 30 1.2 At3g30390.1 68416.m03836 amino acid transporter family protein l... 30 1.5 At3g25790.1 68416.m03210 myb family transcription factor contain... 29 2.0 At2g28800.2 68415.m03502 chloroplast membrane protein (ALBINO3) ... 29 2.0 At2g28800.1 68415.m03501 chloroplast membrane protein (ALBINO3) ... 29 2.7 At4g25290.1 68417.m03637 deoxyribodipyrimidine photolyase family... 28 4.7 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 4.7 At5g54360.1 68418.m06769 zinc finger (C2H2 type) family protein-... 28 6.2 At5g38820.1 68418.m04695 amino acid transporter family protein l... 28 6.2 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 28 6.2 At2g31940.1 68415.m03901 expressed protein 28 6.2 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 6.2 At5g06260.1 68418.m00700 nucleolar protein-related contains weak... 27 8.2 >At4g36720.1 68417.m05210 abscisic acid-responsive HVA22 family protein low similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 227 Score = 98.7 bits (235), Expect = 3e-21 Identities = 48/123 (39%), Positives = 70/123 (56%), Gaps = 5/123 (4%) Frame = +2 Query: 251 GLVAFTGLYLVFG-FGAELI----CNSIGFVYPAYMSMKALESPQKDDDTKWLTYWVVYA 415 GL GL ++F + ++ C SIG P Y + KA+ES +++ K L YW Y Sbjct: 17 GLTGEVGLRVLFSPLSSNIVLRTACCSIGIGLPVYSTFKAIESGDENEQQKMLIYWAAYG 76 Query: 416 CFSIVEYFSDFIVGWFPLYWLLKCIFVIWCYLPTEYNGSLVIYYRIIRPYYQKHHGRIDD 595 FS+VE F+D I+ WFPLY+ +K F++W LPT GS IY IRP+ +H R+D Sbjct: 77 SFSLVEVFTDKIISWFPLYYHVKFAFLVWLQLPT-VEGSKQIYNNQIRPFLLRHQARVDQ 135 Query: 596 MAN 604 + + Sbjct: 136 LVD 138 >At4g24960.1 68417.m03576 ABA-responsive protein (HVA22d) identical to AtHVA22d [Arabidopsis thaliana] GI:4884938 Length = 135 Score = 85.4 bits (202), Expect = 3e-17 Identities = 32/84 (38%), Positives = 54/84 (64%) Frame = +2 Query: 326 VYPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWC 505 +YP Y S+ A+ES K DD +WL YW++Y+ S+ E ++ W P+++ +K +FV W Sbjct: 22 LYPLYASVIAMESTTKVDDEQWLAYWIIYSFLSLTELILQSLIEWIPIWYTVKLVFVAWL 81 Query: 506 YLPTEYNGSLVIYYRIIRPYYQKH 577 LP ++ G+ IY R++R ++KH Sbjct: 82 VLP-QFQGAAFIYNRVVREQFKKH 104 >At5g50720.1 68418.m06285 ABA-responsive protein (HVA22e) identical to AtHVA22e [Arabidopsis thaliana] GI:11225589 Length = 116 Score = 81.0 bits (191), Expect = 6e-16 Identities = 30/84 (35%), Positives = 54/84 (64%) Frame = +2 Query: 326 VYPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWC 505 +YP Y S+ A+ESP K DD +WL YW++Y+ ++ E ++ W P+++ K +FV W Sbjct: 22 LYPLYASVIAIESPSKVDDEQWLAYWILYSFLTLSELILQSLLEWIPIWYTAKLVFVAWL 81 Query: 506 YLPTEYNGSLVIYYRIIRPYYQKH 577 LP ++ G+ IY +++R ++K+ Sbjct: 82 VLP-QFRGAAFIYNKVVREQFKKY 104 >At1g69700.1 68414.m08021 ABA-responsive protein (HVA22c) identical to AtHVA22c [Arabidopsis thaliana] GI:4884936 Length = 184 Score = 78.6 bits (185), Expect = 3e-15 Identities = 34/85 (40%), Positives = 52/85 (61%) Frame = +2 Query: 317 IGFVYPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFV 496 + VYP Y S+KA+E+ +D +WLTYWV+YA S+ E + WFP++ +K + Sbjct: 26 VTLVYPLYASVKAIETRSLPEDEQWLTYWVLYALISLFELTFSKPLEWFPIWPYMKLFGI 85 Query: 497 IWCYLPTEYNGSLVIYYRIIRPYYQ 571 W LP ++NG+ IY IRP+Y+ Sbjct: 86 CWLVLP-QFNGAEHIYKHFIRPFYR 109 >At2g42820.1 68415.m05301 abscisic acid-responsive HVA22 family protein contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 158 Score = 76.2 bits (179), Expect = 2e-14 Identities = 32/88 (36%), Positives = 51/88 (57%) Frame = +2 Query: 302 LICNSIGFVYPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLL 481 L+ + +YP Y S +A+ESP DD +WLTYW++Y+ +I E ++ W P + L Sbjct: 14 LVGPGVMLLYPLYASFRAIESPTMLDDQQWLTYWIIYSLITIFELSVWRVLAWLPFWPYL 73 Query: 482 KCIFVIWCYLPTEYNGSLVIYYRIIRPY 565 K +F +W LP ++G+ IY +R Y Sbjct: 74 KLLFCMWLVLPM-FSGAAYIYSNFVRQY 100 >At1g74520.1 68414.m08633 ABA-responsive protein (HVA22a) identical to AtHVA22a [Arabidopsis thaliana] GI:4884932 Length = 177 Score = 73.3 bits (172), Expect = 1e-13 Identities = 27/84 (32%), Positives = 50/84 (59%) Frame = +2 Query: 317 IGFVYPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFV 496 + VYP Y S++A+E+ DD +WLTYWV+Y+ +++E ++ W P++ +K I Sbjct: 24 VSLVYPLYASVQAIETQSHADDKQWLTYWVLYSLLTLIELTFAKLIEWLPIWSYMKLILT 83 Query: 497 IWCYLPTEYNGSLVIYYRIIRPYY 568 W +P ++G+ +Y +RP + Sbjct: 84 CWLVIP-YFSGAAYVYEHFVRPVF 106 >At5g42560.1 68418.m05180 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 296 Score = 68.9 bits (161), Expect = 3e-12 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 2/94 (2%) Frame = +2 Query: 317 IGFVYPAYMSMKALES--PQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCI 490 +G+ YPAY K +E P+ + W YW++ AC ++ E D V W P+Y K Sbjct: 14 LGYAYPAYECYKTVEKNRPEIEQLRFWCQYWILVACLTVFERVGDAFVSWVPMYSEAKLA 73 Query: 491 FVIWCYLPTEYNGSLVIYYRIIRPYYQKHHGRID 592 F I+ + P + G+ +Y RPY +H ID Sbjct: 74 FFIYLWYP-KTRGTTYVYESFFRPYLSQHENDID 106 >At1g75700.1 68414.m08794 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 166 Score = 68.9 bits (161), Expect = 3e-12 Identities = 32/93 (34%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = +2 Query: 320 GFVYPAYMSMKALE--SPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIF 493 G+ YPAY K +E P+ W YW++ A +I E D +V W P+Y K F Sbjct: 4 GYAYPAYECFKTVELNKPEIQQLQFWCQYWIIVAALTIFERIGDALVSWLPMYSEAKLAF 63 Query: 494 VIWCYLPTEYNGSLVIYYRIIRPYYQKHHGRID 592 I+ + P + G+ +Y RPY KH ID Sbjct: 64 FIYLWFP-KTKGTTYVYDSFFRPYIAKHENEID 95 >At2g36020.1 68415.m04423 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 258 Score = 68.5 bits (160), Expect = 4e-12 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 2/103 (1%) Frame = +2 Query: 290 FGAELICNSIGFVYPAYMSMKALESPQKDDDTK--WLTYWVVYACFSIVEYFSDFIVGWF 463 F L+ +G+ YPA+ K +E + D + W YW++ A S E DF + W Sbjct: 5 FIIRLLVLILGYTYPAFECFKTVEKNKVDIEELRFWCQYWILLALISSFERVGDFFISWL 64 Query: 464 PLYWLLKCIFVIWCYLPTEYNGSLVIYYRIIRPYYQKHHGRID 592 PLY +K +F ++ + P + G+ +Y +++PY +H ID Sbjct: 65 PLYGEMKVVFFVYLWYP-KTKGTRHVYETLLKPYMAQHETEID 106 >At5g62490.1 68418.m07843 ABA-responsive protein (HVA22b) identical to AtHVA22b [Arabidopsis thaliana] GI:4884934 Length = 167 Score = 68.1 bits (159), Expect = 5e-12 Identities = 31/88 (35%), Positives = 44/88 (50%) Frame = +2 Query: 317 IGFVYPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFV 496 I VYP Y S++A+ES DD +WLTYW +Y+ + E ++ W PLY K Sbjct: 24 ISLVYPLYASVRAIESRSHGDDKQWLTYWALYSLIKLFELTFFRLLEWIPLYPYAKLALT 83 Query: 497 IWCYLPTEYNGSLVIYYRIIRPYYQKHH 580 W LP NG+ +Y +R + H Sbjct: 84 SWLVLP-GMNGAAYLYEHYVRSFLLSPH 110 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 67.3 bits (157), Expect = 8e-12 Identities = 32/93 (34%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = +2 Query: 320 GFVYPAYMSMKALES--PQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIF 493 G+ YPAY KA+E P+ W YW++ A +I E D + W PLY K F Sbjct: 15 GYAYPAYECYKAVEKNKPEMQQLRFWCQYWILVAALTIFERVGDALASWVPLYCEAKLAF 74 Query: 494 VIWCYLPTEYNGSLVIYYRIIRPYYQKHHGRID 592 I+ + P + G+ +Y +PY KH ID Sbjct: 75 FIYLWFP-KTRGTTYVYDSFFQPYVAKHENEID 106 >At5g38150.1 68418.m04598 expressed protein Length = 574 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 297 APKPNTKYKPVNATKPKKMYNLFTPTF 217 +PKP K+ PV KP++ ++ TPTF Sbjct: 528 SPKPVGKFTPVQRGKPRRYSSVGTPTF 554 >At2g18950.1 68415.m02212 homogentisate phytylprenyltransferase family protein (HPT1) / tocopherol phytyltransferase family protein (TPT1) identical to gi:17104828; contains Pfam profile PF01040: UbiA prenyltransferase family; identical to cDNA tocopherol polyprenyltransferase (TPT1) GI:17104827 Length = 393 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 407 VYACFSIVEYFSDFIVGWFPLYWLLKCIFVI 499 + A FSI+ ++ +IVG +PL+W L F++ Sbjct: 186 IVASFSIMSFWLGWIVGSWPLFWALFVSFML 216 >At3g30390.1 68416.m03836 amino acid transporter family protein low similarity to neuronal glutamine transporter [Rattus norvegicus] GI:6978016; belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 460 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = +2 Query: 242 IFLGLVAFTGLYLVFGFGAELICNSIGFVYPAYMSMKALESPQKDDDTKWLTYWVVYACF 421 IFLG ++ F F +GF++PA + +K + DT + +V A Sbjct: 380 IFLGANFIPSIWDAFQFTGATAAVCLGFIFPASIILKDRHDKATNRDTTLAIFMIVLAVL 439 Query: 422 S-IVEYFSD 445 S + +SD Sbjct: 440 SNAIAIYSD 448 >At3g25790.1 68416.m03210 myb family transcription factor contains Pfam domain, PF00249: Myb-like DNA-binding domain Length = 357 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 16 CQIVAVLKRERRQIILLPAQLPICVHI 96 C+ + L+ ERR+I + +LP+CV + Sbjct: 19 CEYIEALEEERRKINVFQRELPLCVEL 45 >At2g28800.2 68415.m03502 chloroplast membrane protein (ALBINO3) Oxa1p homolog {PMID:11148275}; identical to chloroplast membrane protein ALBINO3 [Arabidopsis thaliana] GI:2209332 Length = 348 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +2 Query: 338 YMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLL 481 Y+SM+ ++ PQ DD + T V ++ YF+ + +YWL+ Sbjct: 293 YVSMEIMKPPQTDDPAQKNTLLVFKFLPLMIGYFALSVPSGLSIYWLV 340 >At2g28800.1 68415.m03501 chloroplast membrane protein (ALBINO3) Oxa1p homolog {PMID:11148275}; identical to chloroplast membrane protein ALBINO3 [Arabidopsis thaliana] GI:2209332 Length = 462 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 338 YMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWL 478 Y+SM+ ++ PQ DD + T V ++ YF+ + +YWL Sbjct: 293 YVSMEIMKPPQTDDPAQKNTLLVFKFLPLMIGYFALSVPSGLSIYWL 339 >At4g25290.1 68417.m03637 deoxyribodipyrimidine photolyase family protein / DNA photolyase family protein contains Pfam domain, PF00875: deoxyribodipyrimidine photolyase Length = 581 Score = 28.3 bits (60), Expect = 4.7 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 2/73 (2%) Frame = +2 Query: 134 LQEYKDNIEQSLNDKSKPWTKYFELAEQKVGVNRLYIFLGLVAFTGLYL--VFGFGAELI 307 L+ Y+DN++ +N K++ WT + N +Y L ++ V G A + Sbjct: 356 LEHYRDNVDNIVNSKNRVWTITVLGFGKSEKPNIIYTELLWAELLRDFMAEVVGEPAHCV 415 Query: 308 CNSIGFVYPAYMS 346 NSIG + A M+ Sbjct: 416 GNSIGGYFVALMA 428 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.3 bits (60), Expect = 4.7 Identities = 22/62 (35%), Positives = 30/62 (48%) Frame = -3 Query: 542 RSRGTRCIQSAGSTRSRRCTLTASTMETSRR*NRKSTPR*KNRRTPPNM*AILYRHPSAV 363 +SR R S RSRR + S+ E+S RKS+ + KNR P RH S+ Sbjct: 802 KSRSRRRSVSPSPVRSRRKRSSPSSDESSDDSKRKSSSKRKNRSPSPG--KSRRRHVSSR 859 Query: 362 TP 357 +P Sbjct: 860 SP 861 >At5g54360.1 68418.m06769 zinc finger (C2H2 type) family protein-related contains Prosite:PS00028: Zinc finger, C2H2 type, domain. Length = 270 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +2 Query: 62 YCPLNFRSAFTFG*PLKDRTMASKLQEYKDNIEQSLNDKSKPWT 193 +C NF+S F G +K +L++ + IE ++ S P+T Sbjct: 85 FCKRNFKSCFALGGHMKCHKKERELEKQRKIIEDAMLCDSTPFT 128 >At5g38820.1 68418.m04695 amino acid transporter family protein low similarity to N system amino acids transporter NAT-1 [Mus musculus] GI:7406950; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 456 Score = 27.9 bits (59), Expect = 6.2 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = +2 Query: 242 IFLGLVAFTGLYLVFGFGAELICNSIGFVYPAYMSMKALESPQKDDDTKWLTYWVVYACF 421 IFLG ++ F F IGF++PA + +K + D +V A F Sbjct: 374 IFLGANFIPSIWDAFQFTGATAAVCIGFIFPAAVILKDRHNQATKRDKTIAICMIVLAVF 433 Query: 422 S-IVEYFSD 445 S + +SD Sbjct: 434 SNAIAIYSD 442 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 311 NSIGFVYPAYMSMKALESPQKDDDTKWLTYWVVYACF 421 NS GFVY + S++A + Q+ +W ++ A F Sbjct: 479 NSAGFVYLRFQSVEAAAAAQRAMHMRWFAQKMISATF 515 >At2g31940.1 68415.m03901 expressed protein Length = 120 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 317 IGFVYPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPL 469 +G + + + + ES + T W +++ F +V Y S F WFPL Sbjct: 69 VGGMMTSLIHLNERESLYRAGGTPWGVAFMLVFLFFMVSYQSQFQERWFPL 119 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = -3 Query: 542 RSRGTRCIQSAGSTRSRRCTLTASTMETSRR*NRKSTPR*KNRRTPP 402 +SR R S RSRR + S+ E+S RKS+ + KNR P Sbjct: 832 KSRSRRRSVSPSPVRSRRKRSSPSSDESSDDSKRKSSSKRKNRSPSP 878 >At5g06260.1 68418.m00700 nucleolar protein-related contains weak similarity to nucleolar protein C7C (GI:13540302) [Rattus norvegicus] Length = 424 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +2 Query: 491 FVIWC-YLPT--EYNGSLVIYYRIIRPYYQKHHGRIDDMANTD 610 F WC ++PT ++ GSL++ +RP YQ H +D ++D Sbjct: 172 FRSWCSFVPTIRKFLGSLLMPPSTVRPGYQVPHLLYEDSVSSD 214 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,512,583 Number of Sequences: 28952 Number of extensions: 321644 Number of successful extensions: 898 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -