BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g20r (744 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT021252-1|AAX33400.1| 553|Drosophila melanogaster RE60459p pro... 29 5.1 AE014297-2215|AAN13711.1| 698|Drosophila melanogaster CG14897-P... 29 5.1 AE014297-2214|AAF55320.1| 1298|Drosophila melanogaster CG14897-P... 29 5.1 >BT021252-1|AAX33400.1| 553|Drosophila melanogaster RE60459p protein. Length = 553 Score = 29.5 bits (63), Expect = 5.1 Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -3 Query: 157 IYNREFNDALEL-DTIVNASGDRKAVGHDGEVSGLPEIYSW 38 IYN+ D + L D ++A+G R + H G+++ ++Y+W Sbjct: 61 IYNKSSGDPIHLNDVAIHAAGKRPLL-HGGKITIRDKVYTW 100 >AE014297-2215|AAN13711.1| 698|Drosophila melanogaster CG14897-PA, isoform A protein. Length = 698 Score = 29.5 bits (63), Expect = 5.1 Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -3 Query: 157 IYNREFNDALEL-DTIVNASGDRKAVGHDGEVSGLPEIYSW 38 IYN+ D + L D ++A+G R + H G+++ ++Y+W Sbjct: 61 IYNKSSGDPIHLNDVAIHAAGKRPLL-HGGKITIRDKVYTW 100 >AE014297-2214|AAF55320.1| 1298|Drosophila melanogaster CG14897-PB, isoform B protein. Length = 1298 Score = 29.5 bits (63), Expect = 5.1 Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -3 Query: 157 IYNREFNDALEL-DTIVNASGDRKAVGHDGEVSGLPEIYSW 38 IYN+ D + L D ++A+G R + H G+++ ++Y+W Sbjct: 61 IYNKSSGDPIHLNDVAIHAAGKRPLL-HGGKITIRDKVYTW 100 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,605,927 Number of Sequences: 53049 Number of extensions: 666283 Number of successful extensions: 2394 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2380 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3375989364 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -