BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g20r (744 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 35 0.065 At5g62220.1 68418.m07813 exostosin family protein contains Pfam ... 30 1.4 At1g64260.1 68414.m07281 zinc finger protein-related contains Pf... 30 1.4 At1g49920.1 68414.m05598 zinc finger protein-related weak simila... 29 2.5 At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase f... 28 5.7 At4g16050.1 68417.m02435 expressed protein 28 5.7 At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 27 9.9 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 27 9.9 At4g21550.1 68417.m03113 transcriptional factor B3 family protei... 27 9.9 At2g30395.1 68415.m03700 expressed protein 27 9.9 At1g18830.1 68414.m02345 transducin family protein / WD-40 repea... 27 9.9 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 34.7 bits (76), Expect = 0.065 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 601 LIIDKRRNTMEYCYKLWVGNGQDIVKKYFPLSF 503 +++D + EY KL + +G D KYFPL+F Sbjct: 386 IVVDTKNLNCEYQLKLMIASGVDAANKYFPLAF 418 >At5g62220.1 68418.m07813 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 517 Score = 30.3 bits (65), Expect = 1.4 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Frame = +3 Query: 60 PETSPSCPTAL----RSPEAFTIVSSSKASLNSRL*MKNRTSFSYLAGWKNHCSLVLSAL 227 P ++PS P L R+P++ T + K S NS + NR+S Y+A ++HC+ ++ +L Sbjct: 3 PVSNPSSPEHLLKKSRTPDSTTSIDR-KNSFNSLHSVGNRSS--YIAASRSHCTWLILSL 59 Query: 228 L 230 L Sbjct: 60 L 60 >At1g64260.1 68414.m07281 zinc finger protein-related contains Pfam profiles PF03108: MuDR family transposase, PF04434: SWIM zinc finger Length = 719 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -3 Query: 601 LIIDKRRNTMEYCYKLWVGNGQDIVKKYFPLSF 503 +++D + +Y KL + +G D K+FPL+F Sbjct: 379 IVVDTKSLNGKYQLKLMIASGVDAANKFFPLAF 411 >At1g49920.1 68414.m05598 zinc finger protein-related weak similarity to mudrA [Zea mays] GI:540581, MURAZC [Zea mays] GI:1857256; contains Pfam profiles PF03108: MuDR family transposase, PF04434: SWIM zinc finger Length = 785 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/76 (28%), Positives = 36/76 (47%) Frame = -3 Query: 730 SNPDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRNTMEYCYKLW 551 SN L D Y+S LT D + A + L + Q+ +++D + +Y KL Sbjct: 340 SNGLLVDWQYDS-LTHDPEHASFRGLFWAFSQSIQGFQHCRPLIVVDTKNLGGKYKMKLM 398 Query: 550 VGNGQDIVKKYFPLSF 503 + + D +YFPL+F Sbjct: 399 IASAFDATNQYFPLAF 414 >At5g65450.1 68418.m08231 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 16 (UBP16) [Arabidopsis thaliana] GI:11993477; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 731 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/77 (24%), Positives = 35/77 (45%) Frame = +3 Query: 84 TALRSPEAFTIVSSSKASLNSRL*MKNRTSFSYLAGWKNHCSLVLSALLPPYTTRSRALQ 263 T+ S + + SSS L S+ K + S + +G K V+ PP +++ Sbjct: 244 TSEPSSASAAMSSSSTLLLPSKANSKPKVSQASSSGLKTSVQKVVQHFRPPQSSKKSQPS 303 Query: 264 LQVDVLIFKYWLYLVLW 314 +D + F Y L++ L+ Sbjct: 304 SSIDEMSFSYELFVKLY 320 >At4g16050.1 68417.m02435 expressed protein Length = 666 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 193 QPAKYENDVLFFIYNREFNDALELDTIVNASGDRKAVGHDGEVSGLPE 50 + A+ E+D I R N + D I N G+R + D VSGLP+ Sbjct: 535 ESAETEDDDNMTIAQR-INSRKKSDDIENTEGERSRLVADNNVSGLPQ 581 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -3 Query: 712 DKLY--NSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRR 581 +KL+ NS L+ Y ++ S ++E+Q + + QNV ++DK R Sbjct: 298 EKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 343 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -3 Query: 712 DKLY--NSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRR 581 +KL+ NS L+ Y ++ S ++E+Q + + QNV ++DK R Sbjct: 299 EKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 344 >At4g21550.1 68417.m03113 transcriptional factor B3 family protein low similarity to SP|Q01593 Abscisic acid-insensitive protein 3 {Arabidopsis thaliana}, SP|P37398 Viviparous protein homolog {Oryza sativa}; contains Pfam profile PF02362: B3 DNA binding domain Length = 721 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +1 Query: 625 CCPGLGSRIPSSYVQHCRSHR*GCCCTVC---PRGLG*K-GSCC 744 C G I + +H R HR GC C +C P G+G K CC Sbjct: 545 CTEVEGLLISPTTTKHPR-HRDGCTCIICIQSPSGIGPKHDRCC 587 >At2g30395.1 68415.m03700 expressed protein Length = 195 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 736 SPSNPDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQN 614 SP P KL+ S +T Y S RKSL + + V++ Sbjct: 96 SPLTPATAKKLFTSPITTPYSSRTRKSLNARDTFEDNAVED 136 >At1g18830.1 68414.m02345 transducin family protein / WD-40 repeat family protein similar to Sec31p (GI:13928450) {Oryza sativa} Length = 969 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -3 Query: 730 SNPDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNV 611 S+P +D + S++ GDY AV + ++ +V Sbjct: 495 SDPTFDDAIQRSLIVGDYKEAVAQCFSANKMADALVIAHV 534 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,969,411 Number of Sequences: 28952 Number of extensions: 298703 Number of successful extensions: 846 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 846 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -