BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g18f (612 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX537728-1|CAD97821.1| 609|Homo sapiens hypothetical protein pr... 31 4.2 AB095938-1|BAC23114.1| 1685|Homo sapiens KIAA2018 protein protein. 31 4.2 >BX537728-1|CAD97821.1| 609|Homo sapiens hypothetical protein protein. Length = 609 Score = 30.7 bits (66), Expect = 4.2 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = +1 Query: 196 SEGKEGRGYQGSREASDRKRQEEHHGLRLPVMDKGWKGNRQILLPHPV*SDLHRADCQAH 375 SE + G QGSR SD+ + L +P N Q + H V SD+ +DCQ Sbjct: 45 SEQRMGISIQGSR-VSDQLEMRSY--LDVPRNKSLAIHNMQGRVDHTVASDIRLSDCQTF 101 Query: 376 KQKGPS-RPQVDRPTKPQQN 432 K G S +PQ + + +N Sbjct: 102 KPSGASQQPQSNFEVQSSRN 121 >AB095938-1|BAC23114.1| 1685|Homo sapiens KIAA2018 protein protein. Length = 1685 Score = 30.7 bits (66), Expect = 4.2 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = +1 Query: 196 SEGKEGRGYQGSREASDRKRQEEHHGLRLPVMDKGWKGNRQILLPHPV*SDLHRADCQAH 375 SE + G QGSR SD+ + L +P N Q + H V SD+ +DCQ Sbjct: 1121 SEQRMGISIQGSR-VSDQLEMRSY--LDVPRNKSLAIHNMQGRVDHTVASDIRLSDCQTF 1177 Query: 376 KQKGPS-RPQVDRPTKPQQN 432 K G S +PQ + + +N Sbjct: 1178 KPSGASQQPQSNFEVQSSRN 1197 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,005,536 Number of Sequences: 237096 Number of extensions: 2032122 Number of successful extensions: 5946 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5946 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6522878360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -