BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g16r (753 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 27 0.47 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 24 5.8 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 5.8 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 27.5 bits (58), Expect = 0.47 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 399 SNKHRSTLVANCARSLTARQGASRALTDDSRALSPDSGAHRAGDTVSASSSTT 557 SN HR+T A+ S+ A G A L DSGA A +A+++ + Sbjct: 588 SNHHRTTEQADREASVCAAGGVGAAAAAGVGGLGCDSGAAAAAAAAAAAAAAS 640 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.8 bits (49), Expect = 5.8 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 7/36 (19%) Frame = -2 Query: 245 EPGLRGRSTSPRHAGEEAGAGKR-------LSGQPG 159 EPG GRS AG+ G+R L GQPG Sbjct: 312 EPGEPGRSGEKGQAGDRGQVGERGHKGEKGLPGQPG 347 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.8 bits (49), Expect = 5.8 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 223 RRLRDMLERKPELARDFLGNQGITSITGMEALQILNQRT 107 R R +ER AR NQG+ + +AL + + T Sbjct: 1180 RMRRREMERLRRTARRVPSNQGVREVLSADALAAITEAT 1218 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 656,188 Number of Sequences: 2352 Number of extensions: 11805 Number of successful extensions: 30 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -