BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g15r (751 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0199 - 12559351-12559433,12559693-12559827,12560260-125604... 28 9.1 03_04_0116 + 17406702-17409008,17409385-17409501,17409502-17409561 28 9.1 >04_03_0199 - 12559351-12559433,12559693-12559827,12560260-12560437, 12560848-12561389,12561398-12564827 Length = 1455 Score = 27.9 bits (59), Expect = 9.1 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -1 Query: 502 FHLQQIAGDITHN-ITKLLPYIGHVQIAQVPNRNEPDTPGEINYKYVLEHLAKSG 341 FHL + +TH + L H+Q+ + + P P +IN L HLA+ G Sbjct: 537 FHL--LLERVTHEALPHALSKCYHLQVLDIGSYGSPLIPDDINNLVSLRHLAQKG 589 >03_04_0116 + 17406702-17409008,17409385-17409501,17409502-17409561 Length = 827 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 455 FRNIMSNVASDLLKMKNVQHQSQIWTVNTFNNVHS-SSIITQEIFGHRILVDW 610 F I SN + + N ++++ +WT N VH+ S++T + G +L D+ Sbjct: 53 FLTIYSNAFAFSIWYTNSKNKTVVWTANRGRPVHARRSVVTLQKDGAMVLKDY 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,271,789 Number of Sequences: 37544 Number of extensions: 355483 Number of successful extensions: 823 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -