BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g15f (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC25H2.02 |ths1||threonine-tRNA ligase Ths1 |Schizosaccharomyc... 28 1.0 SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces po... 28 1.0 SPAC24C9.08 |||vacuolar carboxypeptidase |Schizosaccharomyces po... 27 3.1 SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces... 26 5.3 SPBC21.07c |ppk24||serine/threonine protein kinase Ppk24|Schizos... 26 5.3 SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schiz... 25 7.1 SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 re... 25 7.1 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 7.1 SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces po... 25 7.1 SPBC839.16 |||C-1-tetrahydrofolate synthase|Schizosaccharomyces ... 25 7.1 SPAC3G9.09c |tif211||translation initiation factor eIF2 alpha su... 25 9.3 SPBC13G1.02 |||mannose-1-phosphate guanyltransferase |Schizosacc... 25 9.3 SPCC1259.12c |||Ran GTPase binding protein |Schizosaccharomyces ... 25 9.3 >SPBC25H2.02 |ths1||threonine-tRNA ligase Ths1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 703 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 443 KRREYPRTNRTNQPVFYAQIFLE*LWKSCGHY*TY*QSKFEIDV 574 K Y + R Q V ++ LWK+ GH+ Y ++ F D+ Sbjct: 326 KYMRYQYSKRGYQEVITPNMYNVNLWKTSGHWNNYSENMFSFDI 369 >SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces pombe|chr 1|||Manual Length = 1159 Score = 28.3 bits (60), Expect = 1.0 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +3 Query: 72 SFMFAEASSIL---ERYALAKDAGFKAVESGFPFGFSLEQVRNAKQSAGL 212 +F F ++S + E +AKDAG A SGF GFS N+ Q A + Sbjct: 963 AFSFGASNSSMNKEENTPMAKDAGDTAPASGFKSGFSF-GANNSPQPASM 1011 >SPAC24C9.08 |||vacuolar carboxypeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 596 Score = 26.6 bits (56), Expect = 3.1 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -2 Query: 472 SISPWIFSPF-RTSTAYSKFFSNVSQCFGVGFSTLPAIM 359 ++ P SP+ +S AY K + FG G S PA+M Sbjct: 492 TLEPSPVSPYDESSDAYKKLAGAIRYTFGDGTSVTPALM 530 >SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 857 Score = 25.8 bits (54), Expect = 5.3 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 303 TNLNTTIEYAKALDAKKIHIMAGKV 377 T+LNT+I++ + + A IH+ KV Sbjct: 179 TDLNTSIKFTENISANAIHVNQDKV 203 >SPBC21.07c |ppk24||serine/threonine protein kinase Ppk24|Schizosaccharomyces pombe|chr 2|||Manual Length = 461 Score = 25.8 bits (54), Expect = 5.3 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 507 LSDYGRAVD-IIKRIDSPNLRLMLDIFHLQQIAGDITHNI 623 +SD+ +D +KRI P +R LD HL+ IA T I Sbjct: 96 MSDFAIGLDPSLKRI-LPEIRFRLDFQHLKSIAKGATSTI 134 >SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schizosaccharomyces pombe|chr 1|||Manual Length = 197 Score = 25.4 bits (53), Expect = 7.1 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -2 Query: 178 SKLKPKGKPDSTALNPASLAKAYRSKMEEASANIKDRLAQ 59 SKL+ + K S A A LAK + +A++++ +LA+ Sbjct: 155 SKLEERRKVKSAAFYQAKLAKQKKIASAKAASSVNGKLAE 194 >SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 402 ETFEKNLLYAVDVLKGENI 458 E FEKN+L +V+ + GEN+ Sbjct: 220 EKFEKNILASVNAVFGENL 238 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 377 HFTSHYVNFFRVQGLRIFDC 318 H+TSH VN + ++FDC Sbjct: 704 HYTSHLVNTIMRKVSKVFDC 723 >SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 472 Score = 25.4 bits (53), Expect = 7.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 408 TSPNVSELDFPLYQPLCEFFSRPRPSHIRLSY 313 T PN LDF LC PR +H+R+ Y Sbjct: 235 TIPNA--LDFLFMPSLCYQLYYPRTAHVRIHY 264 >SPBC839.16 |||C-1-tetrahydrofolate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 937 Score = 25.4 bits (53), Expect = 7.1 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 123 KDAGFKAVESGFPFGFSLEQVRNAK-QSAGLQQIAI 227 K+AG+ E+GF +E+ N K +++GL+ AI Sbjct: 662 KEAGYVVTEAGFASDIGMEKFFNIKCRTSGLKPDAI 697 >SPAC3G9.09c |tif211||translation initiation factor eIF2 alpha subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.0 bits (52), Expect = 9.3 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 184 TCS-KLKPKGKPDSTALNPASLAKAYRSKMEEASANIKD 71 TC+ K+KPK ++ L A L K + + E S + +D Sbjct: 262 TCTVKMKPKAVSETDELELADLMKKFEKENAEISGDEED 300 >SPBC13G1.02 |||mannose-1-phosphate guanyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 414 Score = 25.0 bits (52), Expect = 9.3 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -1 Query: 398 MFRSWIFHFTSHYVNFFRVQGLRIFDC 318 +F+ +I SH+ +F R++ LR ++C Sbjct: 64 VFKDFINEVASHFPSFNRIKYLREYNC 90 >SPCC1259.12c |||Ran GTPase binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 486 Score = 25.0 bits (52), Expect = 9.3 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -1 Query: 329 IFDCRIQICFKFVFFTRNRSYANFTFGRVS 240 I C + + +F+T+N +Y F +VS Sbjct: 179 IIGCGVNFINRTIFYTKNGAYLGVAFKKVS 208 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,571,963 Number of Sequences: 5004 Number of extensions: 52979 Number of successful extensions: 177 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -