BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g15f (644 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0138 - 1069616-1069894,1070056-1070607,1070689-1071046,107... 33 0.19 11_01_0137 - 1137979-1138257,1138419-1138970,1139052-1139409,113... 33 0.19 07_03_1344 - 25912639-25914060 31 0.59 08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969,322... 31 0.78 12_02_1277 + 27497773-27500241 28 7.3 09_06_0244 + 21822811-21823246,21823337-21823468,21823949-218240... 28 7.3 03_04_0116 + 17406702-17409008,17409385-17409501,17409502-17409561 28 7.3 01_05_0773 + 25062364-25062894,25063000-25063244,25063365-250637... 28 7.3 05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613,287... 27 9.7 >12_01_0138 - 1069616-1069894,1070056-1070607,1070689-1071046, 1071214-1071503,1072257-1072360,1072419-1072575, 1073229-1073273,1073636-1073692 Length = 613 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +3 Query: 261 VGVTSVPGKEDEFKTNLNTTIEYAKALDAKKIHIMAGKVENPTPKHWETFEKNLL 425 +GV ++P + N+ T+EY K+ + K+E+PT H+ F KN+L Sbjct: 271 LGVQTMP--KTHHCLNMRLTVEYFKSTSIHTVQSNKQKLEDPTFHHYVIFSKNVL 323 >11_01_0137 - 1137979-1138257,1138419-1138970,1139052-1139409, 1139577-1139869,1140623-1140675,1140785-1140941, 1141666-1141683,1141846-1141929,1142005-1142064, 1142182-1142222,1142316-1142451 Length = 676 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +3 Query: 261 VGVTSVPGKEDEFKTNLNTTIEYAKALDAKKIHIMAGKVENPTPKHWETFEKNLL 425 +GV ++P + N+ T+EY K+ + K+E+PT H+ F KN+L Sbjct: 334 LGVQTMP--KTHHCLNMRLTVEYFKSTSIHTVQSNKQKLEDPTFHHYVIFSKNVL 386 >07_03_1344 - 25912639-25914060 Length = 473 Score = 31.5 bits (68), Expect = 0.59 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +3 Query: 126 DAGFKAVESGFPFGFSLEQVRNAKQSAGLQQIAINLKTGDTTKGEVGV 269 +AG A+ S VR ++A + Q ++ L TG+T GE+GV Sbjct: 244 EAGIGAIASQLADRLPAGSVRLNSRAAAIGQSSVTLDTGETVSGELGV 291 >08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969, 3220080-3223195,3223303-3223561,3223665-3223951, 3224029-3224364,3224463-3224604,3224690-3224910, 3224990-3225151,3225242-3225400,3225488-3225787, 3226306-3226569,3227370-3227453 Length = 1855 Score = 31.1 bits (67), Expect = 0.78 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 426 IANFSQTSPNVSELDFPLYQPLCEFFSRPRPSH 328 ++ +SQTSPN S P Y P +S+P PS+ Sbjct: 1766 LSPYSQTSPNYSPTS-PTYSPTSPSYSQPSPSY 1797 >12_02_1277 + 27497773-27500241 Length = 822 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 9 LLQSRKEIVLN-FIIMKFCANLSFMFAEASSILERYALAKDAGFKAVESGFPF 164 LL S+ +VL+ F++ + A++ + + +E L KD GF+ PF Sbjct: 288 LLVSKINLVLSSFVLPLYVAHVCLSLRQTTDDIEAAGLRKDQGFRVYVMELPF 340 >09_06_0244 + 21822811-21823246,21823337-21823468,21823949-21824037, 21824135-21824224,21825033-21825603,21826097-21826734, 21826978-21827098,21827223-21827337,21828234-21829723, 21829830-21829901,21830151-21830196,21830413-21830515, 21830591-21830674,21831035-21831475,21831651-21831746, 21831896-21832045,21832131-21832274,21832414-21832527, 21832621-21832803,21832901-21832945,21833058-21833192 Length = 1764 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +3 Query: 96 SILERYALAKDAG-FKAVESGFPFGFSLEQVRNAKQSAGLQQIAINLK 236 ++ E+ + +D+G FK ++SGF GFS + V S L + + K Sbjct: 870 TVKEKASACRDSGIFKELKSGFSSGFSSDVVTKFSASPELNKYGLEHK 917 >03_04_0116 + 17406702-17409008,17409385-17409501,17409502-17409561 Length = 827 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -1 Query: 629 FRNIMSNVASDLLKMKNVQHQSQIWTVNTFNNVHS-SSIITQEIFGHRILVDW 474 F I SN + + N ++++ +WT N VH+ S++T + G +L D+ Sbjct: 53 FLTIYSNAFAFSIWYTNSKNKTVVWTANRGRPVHARRSVVTLQKDGAMVLKDY 105 >01_05_0773 + 25062364-25062894,25063000-25063244,25063365-25063749, 25063857-25064282 Length = 528 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 Query: 134 SSVFSQSISFQNGRSFSKHKRQISTEFHYNKI 39 + +FS S++ G + KH+R ++ FH K+ Sbjct: 145 TKLFSDSLANHEGEKWVKHRRILNPAFHLEKL 176 >05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613, 2879715-2879973,2880060-2880346,2880423-2880758, 2880862-2881003,2881077-2881297,2881379-2881540, 2881617-2881775,2881860-2882159,2882834-2883097, 2883133-2883243,2883902-2883988 Length = 1871 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 417 FSQTSPNVSELDFPLYQPLCEFFSRPRPSH 328 +S +SPN P Y P +S+P PS+ Sbjct: 1821 YSPSSPNYYSSTSPTYSPTSPSYSQPSPSY 1850 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,122,777 Number of Sequences: 37544 Number of extensions: 290775 Number of successful extensions: 781 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -