BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g14r (745 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 25 2.5 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.7 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 23 10.0 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 10.0 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 92 PTCIAQSLTAVGGQLWYCRPQVCETSNLIFKLI 190 P C+ ++T + G WY CET ++ K++ Sbjct: 161 PYCVLDTITYMMGGYWY---MACETLSITAKIL 190 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 682 CSWDCTCTCRQLPRRG 729 C CRQLPRRG Sbjct: 1617 CPVQSVTNCRQLPRRG 1632 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 23.0 bits (47), Expect = 10.0 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +3 Query: 597 TGPTVATASISFCSSPSGMSTKPTSSAPVFLGLYLHLS 710 +GP T S + S + PV LG Y+ +S Sbjct: 71 SGPVTTTGSTDTTTPSSAPQDVKAALVPVLLGAYVAMS 108 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.0 bits (47), Expect = 10.0 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +3 Query: 597 TGPTVATASISFCSSPSGMSTKPTSSAPVFLGLYLHLS 710 +GP T S + S + PV LG Y+ +S Sbjct: 81 SGPVTTTGSTDTTTPSSAPQDVKAALVPVLLGAYVAMS 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 624,587 Number of Sequences: 2352 Number of extensions: 10238 Number of successful extensions: 66 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -