BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g14r (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 3.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.0 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 9.2 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 9.2 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 591 TETGPTVATASISFCSSPSGMSTKPTSSAPV 683 ++ P +A +S SP+G P++ AP+ Sbjct: 387 SQVSPVSMSALVSAVRSPAGGQLPPSAGAPM 417 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 709 RQLPRRGRSAR 741 + LPRRGRS+R Sbjct: 1836 KSLPRRGRSSR 1846 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 709 RQLPRRGRSAR 741 + LPRRGRS+R Sbjct: 1832 KSLPRRGRSSR 1842 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 169 RSLTNLRTAIPQLAPDRGQGLGY 101 +S + ++T PQ++PDR + Y Sbjct: 404 QSQSTIQTLRPQVSPDRTSPMEY 426 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 9.2 Identities = 9/41 (21%), Positives = 21/41 (51%) Frame = +2 Query: 401 LDVAQLAPRAAPRVLHEPVVHALLVGAVTHHQNPVVQVSGG 523 LDV++L + + + ++ +G V H ++ +V+ G Sbjct: 24 LDVSKLTALSREVISRQATINIGTIGHVAHGKSTIVKAISG 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,383 Number of Sequences: 438 Number of extensions: 3137 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -