BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g13r (419 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch... 27 1.6 SPAC4H3.11c |ppc89|mug127|spindle pole body protein Ppc89|Schizo... 24 8.4 >SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2196 Score = 26.6 bits (56), Expect = 1.6 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 271 FSEEDCIRQGGICVRTEECDPDNISTISQFLCP 173 FS DC RQ I + E D ST+ F+CP Sbjct: 1381 FSFVDCTRQITIYLAKTELLSDLYSTLLSFVCP 1413 >SPAC4H3.11c |ppc89|mug127|spindle pole body protein Ppc89|Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 24.2 bits (50), Expect = 8.4 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +1 Query: 112 GKKTPSFFRHSSRLLQGALGLD 177 GK+TPS ++ S+RL++ LGL+ Sbjct: 211 GKETPSSYKASARLME-QLGLN 231 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,707,115 Number of Sequences: 5004 Number of extensions: 32849 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 148351622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -