BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g13r (419 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 27 0.37 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 3.4 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 4.5 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 4.5 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 23 6.0 AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding pr... 22 7.9 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 26.6 bits (56), Expect = 0.37 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 304 VCSSPLLTQTPFSEEDCIRQGGICVRTEECDPDNISTIS 188 + + LLT +E+DC+R GG + +P NI+ +S Sbjct: 854 IMAKALLTNRYVTEQDCLRVGGQHISCAG-NPPNIAAVS 891 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.4 bits (48), Expect = 3.4 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Frame = -2 Query: 361 LKMKLIQCV-FVIVLLMAVTVC--SSPLLTQT-PFSEEDCIRQGGI--CVRTEECDPDNI 200 +K+ L+ CV + LL++ T + L Q+ +E +R+ CV T+EC PD + Sbjct: 1 MKLPLLCCVPLLAALLVSSTTAQHAEDALKQSYDGTESSAVREQPEQRCVPTKECPPDEV 60 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.0 bits (47), Expect = 4.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 418 VYFVSHYNRTQGAVPTPKKLKMKLIQCV 335 VYFV H NRT T ++ M ++Q + Sbjct: 390 VYFVDHNNRTTQF--TDPRINMHILQMI 415 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.0 bits (47), Expect = 4.5 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 200 YVVWITFLRAHAYT 241 +V W++F + H YT Sbjct: 93 FVTWLSFFQVHIYT 106 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -2 Query: 352 KLIQCVFVIVLLMAVTVCSSPLLTQTPFSEEDCIRQGGICVRTEEC 215 K++ CV +++LL + V +TP + G+C ++C Sbjct: 3 KVVDCVLLLLLLAFIAVVRGQEACRTPDHRD------GVCHPVQQC 42 >AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding protein OBPjj83a protein. Length = 285 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -2 Query: 274 PFSEEDCIRQGGICVRTEECDPDNISTISQFLCPN 170 PF ++ IR IC + + D Q + PN Sbjct: 161 PFDAQEFIRSLSICAKLQRIPKDRRDLYVQGVFPN 195 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 444,064 Number of Sequences: 2352 Number of extensions: 9374 Number of successful extensions: 26 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -