BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g13r (419 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73080.1 68414.m08450 leucine-rich repeat transmembrane prote... 28 2.2 At5g58270.1 68418.m07295 mitochondrial half-ABC transporter (STA... 28 3.0 At4g28630.1 68417.m04093 ABC transporter family protein identica... 28 3.0 At4g22210.1 68417.m03210 hypothetical protein 27 5.2 At3g28040.1 68416.m03500 leucine-rich repeat transmembrane prote... 27 6.8 At4g28620.1 68417.m04092 ABC transporter family protein identica... 26 9.0 >At1g73080.1 68414.m08450 leucine-rich repeat transmembrane protein kinase, putative similar to receptor protein kinase GI:1389566 from [Arabidopsis thaliana] Length = 1123 Score = 28.3 bits (60), Expect = 2.2 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +3 Query: 171 FGHRNCEIVDMLSGSHSSVRTHIPPCLMQSSSLNGVCVSKGLLHTVTAISKTMTK 335 FG NC+ + L S++ +PP L SSL+ + + G L S M K Sbjct: 261 FGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIPSSLGMLK 315 >At5g58270.1 68418.m07295 mitochondrial half-ABC transporter (STA1) identical to half-molecule ABC transporter ATM3 GI:9964121 from [Arabidopsis thaliana]; almost identical to mitochondrial half-ABC transporter STA1 GI:9187883 from [Arabidopsis thaliana]; identical to cDNA mitochondrial half-ABC transporter (STA1 gene)GI:9187882 Length = 728 Score = 27.9 bits (59), Expect = 3.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 282 HKHHSVRRIASDKEVYACARRNVIQTTYRRFRNFY 178 H H R A+++EVY ARR I T F + Y Sbjct: 571 HNIHYGRLSATEEEVYEAARRAAIHETISNFPDKY 605 >At4g28630.1 68417.m04093 ABC transporter family protein identical to half-molecule ABC transporter ATM1 GI:9964117 from [Arabidopsis thaliana] Length = 678 Score = 27.9 bits (59), Expect = 3.0 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 282 HKHHSVRRIASDKEVYACARRNVIQTTYRRFRNFY 178 H H A+++EVY ARR VI T +F + Y Sbjct: 529 HNIHYGNLSATEEEVYDAARRAVIHDTIMKFPDKY 563 >At4g22210.1 68417.m03210 hypothetical protein Length = 86 Score = 27.1 bits (57), Expect = 5.2 Identities = 21/75 (28%), Positives = 27/75 (36%), Gaps = 3/75 (4%) Frame = -2 Query: 331 VIVLLMAVTVCSSPLLTQTPFSEEDCIRQGGICVRTEECDPDNISTISQFL---CPNQAH 161 V +AV VC S LL C G+C C+ S F C + Sbjct: 6 VSTFAVAVVVCLSILLMSPTDGRRVCDSAAGLCSMLFSCNTQCNSLGRNFTGGECSDARF 65 Query: 160 LGVACCYV*RNSVSS 116 G++ CY N SS Sbjct: 66 PGLSVCYCCHNVESS 80 >At3g28040.1 68416.m03500 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profiles: PF00560 leucine rich repeat, PF00069 eukaryotic protein kinase domain Length = 1016 Score = 26.6 bits (56), Expect = 6.8 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 183 NCEIVDMLSGSHSSVRTHIPPCLMQSSSLNGVCVSK 290 NC + LS SH+ + IP L + S LN + +S+ Sbjct: 171 NCSSLRYLSLSHNHLEGQIPSTLFRCSVLNSLNLSR 206 >At4g28620.1 68417.m04092 ABC transporter family protein identical to half-molecule ABC transporter ATM2 GI:9964119 from [Arabidopsis thaliana] Length = 680 Score = 26.2 bits (55), Expect = 9.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 282 HKHHSVRRIASDKEVYACARRNVIQTTYRRFRNFY 178 H H A+++EVY ARR I T +F + Y Sbjct: 531 HNIHYGNLSATEEEVYNAARRAAIHDTIMKFPDKY 565 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,750,816 Number of Sequences: 28952 Number of extensions: 168826 Number of successful extensions: 405 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 645327280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -