BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g13f (476 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16793| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.85 SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 1.1 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_26017| Best HMM Match : Extensin_2 (HMM E-Value=0.11) 28 4.5 >SB_16793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 30.3 bits (65), Expect = 0.85 Identities = 18/73 (24%), Positives = 31/73 (42%) Frame = -3 Query: 264 PRCAWFGHRNCEIVDMLSGSHSSVRTHIPPCLMQSSSLNGVCVSKGLLHTVTAISKTMTK 85 P +F H E+ + + + + CL+ + L +CV KG+ + + T T Sbjct: 136 PSAYYFYHHALEVSTSIEDTGVGINVKLAGCLVFAWILTYLCVVKGIKSSGKVVYFTATF 195 Query: 84 THCISFIFNFLGV 46 + I I F GV Sbjct: 196 PYIILIILFFRGV 208 >SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1063 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 Query: 159 SSLNGVCVSKGLLHTVTAISKTMTKTHCISFIF 61 SS N C+ G T IS THC+ IF Sbjct: 736 SSNNNTCIRTGFFSKYTCISYIRLHTHCVVIIF 768 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 276 QQATPRCAWFGHRNCEIVDMLSGSHSSVRTHIPPCLMQSSSL 151 Q+ P C+ RN E L S S+++ PCL S S+ Sbjct: 1182 QKVAPLCSGSAERNLEGSPRLQASDSTMKAEETPCLPHSGSI 1223 >SB_26017| Best HMM Match : Extensin_2 (HMM E-Value=0.11) Length = 1704 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 219 MLSGSHSSVRTHIPPCLMQSSSLN 148 ++S S R H PPC+ QSSSL+ Sbjct: 960 VVSSSDVPPRKHSPPCVSQSSSLS 983 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,115,293 Number of Sequences: 59808 Number of extensions: 263179 Number of successful extensions: 546 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -