BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g13f (476 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z80216-6|CAB02285.2| 313|Caenorhabditis elegans Hypothetical pr... 27 7.0 Z19157-6|CAA79569.2| 1556|Caenorhabditis elegans Hypothetical pr... 27 7.0 Z81109-1|CAB03245.1| 485|Caenorhabditis elegans Hypothetical pr... 27 9.2 >Z80216-6|CAB02285.2| 313|Caenorhabditis elegans Hypothetical protein F10G8.6 protein. Length = 313 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = +2 Query: 83 VFVIVLLMAVTVCSSPLLTQTP--FSEEDCIRQGGICVRTEECDPDNISTISQFLCPNQA 256 + ++ L+ L+ TP S D ++ CV+T+ + +++F+CPN A Sbjct: 185 ISLVQFLLQAGPLDGALIVSTPQEVSLLDVRKEVSFCVKTKVPILGVVENMARFVCPNCA 244 Query: 257 H 259 H Sbjct: 245 H 245 >Z19157-6|CAA79569.2| 1556|Caenorhabditis elegans Hypothetical protein ZC84.1 protein. Length = 1556 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 176 GGICVRTEECDPDNISTISQFLCPNQAHLGVACCYV 283 GG C +C + + + LC N+A LG AC V Sbjct: 1211 GGFCQEEIQCSSNQV--LHNGLCHNKAKLGEACLTV 1244 >Z81109-1|CAB03245.1| 485|Caenorhabditis elegans Hypothetical protein R10D12.1 protein. Length = 485 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 378 NVYIMPIYIILHYFYFIMLRF 440 + +++PI LH+ FIMLRF Sbjct: 129 STFLIPILAPLHFHLFIMLRF 149 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,844,148 Number of Sequences: 27780 Number of extensions: 198498 Number of successful extensions: 444 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 871571276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -