BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g12f (446 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY043095-1|AAK94799.1| 110|Homo sapiens immunoglobulin light ch... 30 3.1 AY320566-1|AAQ21877.1| 77|Homo sapiens immunoglobulin kappa ch... 29 9.5 >AY043095-1|AAK94799.1| 110|Homo sapiens immunoglobulin light chain variable region protein. Length = 110 Score = 30.3 bits (65), Expect = 3.1 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 284 RFEGWGSRCHYTETLELISQGGWRIYVVDVYGLQ*PLNT 400 RF G GS H+T T+ + + +Y YG PL T Sbjct: 62 RFSGGGSGTHFTLTISRLEPEDFAVYYCQQYGTSPPLFT 100 >AY320566-1|AAQ21877.1| 77|Homo sapiens immunoglobulin kappa chain variable region protein. Length = 77 Score = 28.7 bits (61), Expect = 9.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 284 RFEGWGSRCHYTETLELISQGGWRIYVVDVYG 379 RF GWGS +T T+ + + +Y YG Sbjct: 40 RFSGWGSGTDFTLTISRLEPEDFAVYYCQQYG 71 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,656,430 Number of Sequences: 237096 Number of extensions: 1481568 Number of successful extensions: 2274 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2274 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3644351872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -