BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g11f (607 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66060.1 68418.m08323 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 1.8 At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain... 29 1.8 At4g26570.2 68417.m03831 calcineurin B-like protein 3 (CBL3) ide... 29 1.8 At1g20270.1 68414.m02531 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 2.4 At3g13060.2 68416.m01628 expressed protein contains Pfam profile... 29 3.2 At3g13060.1 68416.m01627 expressed protein contains Pfam profile... 29 3.2 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 29 3.2 At3g57170.1 68416.m06365 N-acetylglucosaminyl transferase compon... 28 4.2 At4g26830.1 68417.m03863 glycosyl hydrolase family 17 protein si... 28 5.5 At5g28120.1 68418.m03396 hypothetical protein 27 7.3 At5g28110.1 68418.m03395 hypothetical protein 27 7.3 At5g18510.1 68418.m02185 hypothetical protein 27 7.3 At4g37130.1 68417.m05258 hydroxyproline-rich glycoprotein family... 27 9.6 At4g26930.1 68417.m03875 myb family transcription factor (MYB97)... 27 9.6 At4g17615.1 68417.m02634 calcineurin B-like protein 1 (CBL1) ide... 27 9.6 At3g60370.1 68416.m06752 immunophilin / FKBP-type peptidyl-proly... 27 9.6 At3g54100.1 68416.m05981 expressed protein similar to axi 1 [Nic... 27 9.6 At2g28700.1 68415.m03488 MADS-box protein-related contains INTER... 27 9.6 >At5g66060.1 68418.m08323 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Rattus norvegicus [GI:474940], Mus musculus [SP|Q60715], Homo sapiens [GI:18073925]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 267 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +1 Query: 310 HRRLQRARCTYLIVAARPLPIPATYRNKKTKSITLSNQRTRSSAPLKR 453 H L + C YLI A+P +T ++KT T S RT S L R Sbjct: 91 HNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLAR 138 >At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein hypothetical proteins - Arabidopsis thaliana contains Pfam profile PF00564: PB1 domain Length = 476 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +3 Query: 273 GMAAFMYR-QPEAAQAPSTGQVYIPDRRRQTLADTSYVPQQENEVYYPQQPE-NPIF 437 G FM + Q + Q TGQ YI TL T+Y N VYY + P+ PI+ Sbjct: 317 GYPPFMNQAQQQHIQVIYTGQPYITGNSPMTLPATAY--HHTNHVYYQRPPQPYPIY 371 >At4g26570.2 68417.m03831 calcineurin B-like protein 3 (CBL3) identical to calcineurin B-like protein 3 (GI:22136404) [Arabidopsis thaliana] Length = 230 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = -3 Query: 605 ISDSLLRLGLLNFEYFRLW*FRSGRRFGSLGNRYQSGGVQFDLF 474 IS +++ GL+N E F+L F++ ++ +RYQS FDLF Sbjct: 57 ISSAVIDDGLINKEEFQLALFKTNKKESLFADRYQS--QVFDLF 98 >At1g20270.1 68414.m02531 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Gallus gallus [GI:212530], Rattus norvegicus [GI:474940], Mus musculus [SP|Q60715]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 287 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 310 HRRLQRARCTYLIVAARPLPIPATYRNKKTKSITLSNQRTRSSAPLKR 453 H L + C YLI A+P + +T + +T S RT S L+R Sbjct: 89 HNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFLRR 136 >At3g13060.2 68416.m01628 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 634 Score = 28.7 bits (61), Expect = 3.2 Identities = 29/92 (31%), Positives = 38/92 (41%), Gaps = 5/92 (5%) Frame = +3 Query: 165 YGNVDSLSYGS--GDSNRGGLVMSRYYNPYYNPRAVGGGMAAFMYRQPEAAQAPSTGQVY 338 Y NV+ L S G + LV Y YNP+ G + P A+ PS GQ+Y Sbjct: 100 YVNVEGLDITSPVGFNENASLVYQTGYG--YNPQMPYGPYS------PAASPLPSEGQLY 151 Query: 339 IPDRRRQTLADTSY---VPQQENEVYYPQQPE 425 P + + A Y VP + P QPE Sbjct: 152 SPQQFPFSGASPYYQQVVPPSMQYITSPTQPE 183 >At3g13060.1 68416.m01627 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 551 Score = 28.7 bits (61), Expect = 3.2 Identities = 29/92 (31%), Positives = 38/92 (41%), Gaps = 5/92 (5%) Frame = +3 Query: 165 YGNVDSLSYGS--GDSNRGGLVMSRYYNPYYNPRAVGGGMAAFMYRQPEAAQAPSTGQVY 338 Y NV+ L S G + LV Y YNP+ G + P A+ PS GQ+Y Sbjct: 100 YVNVEGLDITSPVGFNENASLVYQTGYG--YNPQMPYGPYS------PAASPLPSEGQLY 151 Query: 339 IPDRRRQTLADTSY---VPQQENEVYYPQQPE 425 P + + A Y VP + P QPE Sbjct: 152 SPQQFPFSGASPYYQQVVPPSMQYITSPTQPE 183 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 28.7 bits (61), Expect = 3.2 Identities = 22/61 (36%), Positives = 25/61 (40%), Gaps = 4/61 (6%) Frame = +3 Query: 153 YNPYYGNVDSLSYGSGDSNRGGLVMSRYYN----PYYNPRAVGGGMAAFMYRQPEAAQAP 320 Y PY G+ YG G + G Y N PY NP G G + R AQAP Sbjct: 238 YPPYGGSGYGTGYGYGSNGVGYGGFGGYGNPAGAPYGNPSVPGAGFGSGP-RSSWGAQAP 296 Query: 321 S 323 S Sbjct: 297 S 297 >At3g57170.1 68416.m06365 N-acetylglucosaminyl transferase component family protein / Gpi1 family protein similar to SP|O14357 N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 {Schizosaccharomyces pombe}; contains Pfam profile PF05024: N-acetylglucosaminyl transferase component (Gpi1) Length = 560 Score = 28.3 bits (60), Expect = 4.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 403 SITLSNQRTRSSAPLKRPNWLTPL 474 S++ SN ++ APLK+P W+ L Sbjct: 49 SLSFSNSSPQTKAPLKKPKWVDDL 72 >At4g26830.1 68417.m03863 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 448 Score = 27.9 bits (59), Expect = 5.5 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +3 Query: 90 IMKVMYAFVMMSCA-LLVQAYPYNPYYGNVD--SLSYGSGDSNRGGL 221 ++K M A + + + L+V AYP+ Y N D SL Y N G + Sbjct: 179 VVKPMLALLQQTSSYLMVNAYPFFAYAANADKISLDYALFKENAGNI 225 >At5g28120.1 68418.m03396 hypothetical protein Length = 506 Score = 27.5 bits (58), Expect = 7.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 162 YYGNVDSLSYGSGDSNRGGLVMSR 233 Y GN+D + +G GD ++ L+ SR Sbjct: 122 YVGNIDRVRWGPGDKDQKTLIKSR 145 >At5g28110.1 68418.m03395 hypothetical protein Length = 493 Score = 27.5 bits (58), Expect = 7.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 162 YYGNVDSLSYGSGDSNRGGLVMSR 233 Y GN+D + +G GD ++ L+ SR Sbjct: 122 YVGNIDRVRWGPGDKDQKTLIKSR 145 >At5g18510.1 68418.m02185 hypothetical protein Length = 702 Score = 27.5 bits (58), Expect = 7.3 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 426 NPIFSPTQATELADPTEKIE 485 +P+FSP + +E+ D EK+E Sbjct: 137 SPVFSPLECSEMRDSAEKLE 156 >At4g37130.1 68417.m05258 hydroxyproline-rich glycoprotein family protein Length = 513 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +3 Query: 330 QVYIPDRRRQTLADTSYVPQQENEVYYPQQPE--NPIFSPTQ 449 Q P QT + + PQQ N ++ QP+ N IFS +Q Sbjct: 8 QQQTPQPLFQTQQTSLFQPQQTNSIFSQSQPQQTNSIFSQSQ 49 >At4g26930.1 68417.m03875 myb family transcription factor (MYB97) contains Pfam profile: PF00249 myb-like DNA-binding domain ;similar to anther-specific myb-related protein 2 GI:11066263 from [Nicotiana tabacum] Length = 389 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +3 Query: 348 RRRQTLADTSYVPQQENEVYYPQQPENPIFSPTQATELADP 470 R+ L Y + YPQQP +P+ S T A+ P Sbjct: 124 RQGLPLYPPEYSQNNHQQQMYPQQPSSPLPSQTPASSFTFP 164 >At4g17615.1 68417.m02634 calcineurin B-like protein 1 (CBL1) identical to calcineurin B-like protein 1 (GI:3309082) [Arabidopsis thaliana] Length = 213 Score = 27.1 bits (57), Expect = 9.6 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 8/76 (10%) Frame = -3 Query: 605 ISDSLLRLGLLNFEYFRLW*FRSGRRFGSLGNRY-------QSGGVQF-DLFSGVSQFGR 450 IS S++ GL+N E F+L F+S +R NR + G + F D ++ F Sbjct: 42 ISSSVVDDGLINKEEFQLALFKSRKRENIFANRIFDMFDVKRKGVIDFGDFVRSLNVFHP 101 Query: 449 LSGAEDRVLWLLRVID 402 + ED++ + R+ D Sbjct: 102 NASLEDKIDFTFRLYD 117 >At3g60370.1 68416.m06752 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein SP:Q9M222; similar to FKBP-type peptidyl-prolyl cis-trans isomerase fkpA precursor (PPiase) (Rotamase)(SP:Q8X880) [Escherichia coli O157:H7] ; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 242 Score = 27.1 bits (57), Expect = 9.6 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 289 CTASPKPHRR-LQRARCTYLIVAARPLPIPATYRNKKTKSITLSNQR 426 C+ S +P + L R Y++VA+ L +PA + KTKS + ++R Sbjct: 32 CSLSEEPKDQCLSRRSLVYVLVASPCLLLPALSSSAKTKSKSPYDER 78 >At3g54100.1 68416.m05981 expressed protein similar to axi 1 [Nicotiana tabacum] GI:559921; contains Pfam profile PF03138: Plant protein family Length = 638 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 256 PELWAVVWP---RSCTASPKPHRRLQRARCTYLIVAA 357 PE+W R C PK + RLQR YL+V A Sbjct: 194 PEIWQKPESGNYRQCVTRPKNYTRLQRQTNGYLVVHA 230 >At2g28700.1 68415.m03488 MADS-box protein-related contains INTERPRO: IPR002100 MADS-box domain Length = 329 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/47 (25%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +3 Query: 318 PSTGQVYIPDRRRQTLAD---TSYVPQQENEVYYPQQPENPIFSPTQ 449 P Q IP + D ++++P EVY P ++ +++P Q Sbjct: 248 PDMNQSIIPSNQGAEHVDFLESNFLPNNNQEVYIPVMDQDEVYNPNQ 294 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,556,111 Number of Sequences: 28952 Number of extensions: 276424 Number of successful extensions: 807 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -