BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g10f (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 24 3.5 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 24 4.6 AF203339-1|AAF19834.1| 156|Anopheles gambiae immune-responsive ... 24 4.6 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = -1 Query: 555 LSNIEDTITIAYLMASSRRKVVVGPSSADSANSHHGCFSL 436 L E+ Y + + + ++GP+++ SA GC S+ Sbjct: 238 LKQEEEAFREGYYLPTQAKPEILGPATSMSAALRFGCLSV 277 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 23.8 bits (49), Expect = 4.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 383 VNIICFQELWNMPFAFCTREKQPW 454 VN+I F+ LW PF +P+ Sbjct: 192 VNVIYFKGLWTYPFPEVANNVKPF 215 >AF203339-1|AAF19834.1| 156|Anopheles gambiae immune-responsive serpin-related proteinISerpF1 protein. Length = 156 Score = 23.8 bits (49), Expect = 4.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 383 VNIICFQELWNMPFAFCTREKQPW 454 VN+I F+ LW PF +P+ Sbjct: 93 VNVIYFKGLWTYPFPEVANNVKPF 116 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,836 Number of Sequences: 2352 Number of extensions: 12690 Number of successful extensions: 39 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -