BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g08r (790 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 30 0.071 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 24 6.2 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 30.3 bits (65), Expect = 0.071 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +1 Query: 631 CSMPDQDGACHTSLSCQYNAPIVYQSAWLCR*YSV*TFNDIACESDYK 774 CS P++D A H+S S ++ S L R ++D+AC DY+ Sbjct: 576 CSGPEEDNASHSSASSHGSSDGPSSSEKLKRQAIDSFYHDVACRGDYR 623 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 23.8 bits (49), Expect = 6.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 438 LRCSSGSSEFQEAKH*DRSLGRT 370 LRC S S F ++ + DR GRT Sbjct: 602 LRCLSDHSVFVQSYYLDREAGRT 624 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 819,566 Number of Sequences: 2352 Number of extensions: 16978 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -