BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g08f (579 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 25 0.46 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 1.9 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 22 4.3 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 5.7 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 7.6 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 25.0 bits (52), Expect = 0.46 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 139 LSAAHWKLTNKNGSIAVRGSVPGGVYTDLNKAGIIGDVLYGFNDVLS 279 ++ + W+ N+N A+R + GG D K IG YG + +LS Sbjct: 222 VNESDWQQQNRNADAAIRYWLDGG--ADPQKV-TIGIAFYGHHFILS 265 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 217 YIPHPAQSRGLQSIHSCWSISNEQH 143 Y PH A GLQ +H +++ H Sbjct: 26 YEPHVAHRPGLQGLHHSPHLNHAMH 50 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +3 Query: 201 AGWGIYRSQQSGYH 242 A W IYR + YH Sbjct: 31 ASWAIYRPDKGEYH 44 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 276 EHVIEAIQDISNDTRFVEIGIY 211 EH+ E I+ I N +GIY Sbjct: 49 EHIFERIRTIYNQFSTPYVGIY 70 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 7.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 221 SVYTPPGTEPRTAIDPFLL 165 SV PP +PRT P +L Sbjct: 256 SVSQPPNRKPRTDFKPQVL 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,673 Number of Sequences: 336 Number of extensions: 3049 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -