BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g08f (579 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 6.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 6.7 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 6.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 6.7 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 21 8.8 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -1 Query: 438 EHTARATNWGIVYFHERHCINTIEHQ 361 E ++ + GIV H++ CIN + + Sbjct: 276 EPSSTSKKSGIVRSHQQSCINRVARE 301 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 360 LGVRWY*YSGVRGNKQYPSW*HEQYVREIRV*CQGTNADRRK 485 +GVR Y S + K+ P + Y + ++V NA+ R+ Sbjct: 349 VGVRTYLESELAKAKERPKLRKDMYEKMVQVDPTAPNAEERR 390 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 360 LGVRWY*YSGVRGNKQYPSW*HEQYVREIRV*CQGTNADRRK 485 +GVR Y S + K+ P + Y + ++V NA+ R+ Sbjct: 264 VGVRTYLESELAKAKERPKLRKDMYEKMVQVDPTAPNAEERR 305 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 360 LGVRWY*YSGVRGNKQYPSW*HEQYVREIRV*CQGTNADRRK 485 +GVR Y S + K+ P + Y + ++V NA+ R+ Sbjct: 583 VGVRTYLESELAKAKERPKLRKDMYEKMVQVDPTAPNAEERR 624 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 205 PAQSRGLQSIHSCWSISNE 149 P + RGL SI W ++ E Sbjct: 114 PCEHRGLVSIIDGWELNGE 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,361 Number of Sequences: 438 Number of extensions: 3371 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -