Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner10g07f
         (460 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8AA03 Cluster: Putative uncharacterized protein; n=1; ...    31   9.0  

>UniRef50_Q8AA03 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides thetaiotaomicron|Rep: Putative
           uncharacterized protein - Bacteroides thetaiotaomicron
          Length = 598

 Score = 31.5 bits (68), Expect = 9.0
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +2

Query: 287 FF*LPVSLGIGSTSEADVANFLRKKAFFSLNIIFGIVRIFYVY 415
           F   PVSLGI   +   + +FL KK  F L++   ++ I  VY
Sbjct: 37  FLLFPVSLGICLVTITAILSFLTKKKIFQLSVADVLISILVVY 79


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 382,810,553
Number of Sequences: 1657284
Number of extensions: 6118401
Number of successful extensions: 12344
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12140
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12344
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 24351434270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)