BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g07f (460 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22415| Best HMM Match : TT_ORF2 (HMM E-Value=3.7) 27 5.6 SB_54564| Best HMM Match : 7tm_1 (HMM E-Value=0.54) 27 7.5 >SB_22415| Best HMM Match : TT_ORF2 (HMM E-Value=3.7) Length = 483 Score = 27.5 bits (58), Expect = 5.6 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -1 Query: 448 YVICFKI*NITINVEDTYYTKYNVKTEKGFFTQK 347 YVI F NITI V D Y Y + FF+ K Sbjct: 70 YVISFLTTNITIRVVDVYDFLYGKRPRFTFFSPK 103 >SB_54564| Best HMM Match : 7tm_1 (HMM E-Value=0.54) Length = 191 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 415 INVEDTYYTKYNVKTEKGFFTQK 347 +NVE T +TKY +TE F Q+ Sbjct: 123 MNVERTVFTKYEERTETSFSRQR 145 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,894,713 Number of Sequences: 59808 Number of extensions: 194070 Number of successful extensions: 453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -