BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g06f (311 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q556F5 Cluster: C2H2 type Zn finger-containing protein;... 34 0.54 UniRef50_Q3B4T5 Cluster: Putative uncharacterized protein; n=1; ... 33 1.2 UniRef50_Q8G7Y8 Cluster: Putative uncharacterized protein; n=2; ... 32 2.9 UniRef50_Q4P5A1 Cluster: Putative uncharacterized protein; n=2; ... 32 2.9 UniRef50_Q1D8F1 Cluster: D-aminopeptidase; n=5; Bacteria|Rep: D-... 31 3.8 UniRef50_Q6ALP6 Cluster: Putative uncharacterized protein; n=1; ... 31 6.6 UniRef50_Q4CWK8 Cluster: Putative uncharacterized protein; n=2; ... 31 6.6 UniRef50_UPI000049A291 Cluster: hypothetical protein 74.t00024; ... 30 8.7 UniRef50_A4I4B2 Cluster: Putative uncharacterized protein; n=3; ... 30 8.7 >UniRef50_Q556F5 Cluster: C2H2 type Zn finger-containing protein; n=1; Dictyostelium discoideum AX4|Rep: C2H2 type Zn finger-containing protein - Dictyostelium discoideum AX4 Length = 774 Score = 34.3 bits (75), Expect = 0.54 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -2 Query: 238 NKIIFPLHYVLLLSSPIRALSSVRWGNLPFLPPS-KEKCSDRHNRH 104 NK + P Y + SSP+ S+ GNL FL S ++ D HN H Sbjct: 689 NKSVLPSIYSSMQSSPLSTSSTTSKGNLSFLVSSNNDEDDDHHNHH 734 >UniRef50_Q3B4T5 Cluster: Putative uncharacterized protein; n=1; Pelodictyon luteolum DSM 273|Rep: Putative uncharacterized protein - Pelodictyon luteolum (strain DSM 273) (Chlorobium luteolum (strain DSM273)) Length = 427 Score = 33.1 bits (72), Expect = 1.2 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -2 Query: 250 YYFANKIIFPLHYVLLLSSPIRALSSVRWGNLPFL 146 Y FANK +F ++Y+L+ S I L SV +G + F+ Sbjct: 74 YPFANKPVFWVYYILIFSIGIGILHSVAYGAIAFM 108 >UniRef50_Q8G7Y8 Cluster: Putative uncharacterized protein; n=2; Bifidobacterium longum|Rep: Putative uncharacterized protein - Bifidobacterium longum Length = 567 Score = 31.9 bits (69), Expect = 2.9 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = -3 Query: 192 RFAP*APCGGGTFLSCHQVKRNVPTATTAIAPSAKALAADV 70 RFAP A +F + HQ ++++ TA +AP+A A AA + Sbjct: 251 RFAPAAVAHDESFDALHQAEQSLFTAPAPVAPAAPAAAAPI 291 >UniRef50_Q4P5A1 Cluster: Putative uncharacterized protein; n=2; Dikarya|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 353 Score = 31.9 bits (69), Expect = 2.9 Identities = 21/54 (38%), Positives = 27/54 (50%) Frame = +1 Query: 103 DGGCGGRNISLYLVARKEGSPTARSSRRESAKIVAEHSAAEK*FCSQNNTYVYT 264 D GCG ++SLYL R S S + KI + AAE+ F NN V+T Sbjct: 125 DLGCGWGSLSLYLAERYPNSRIYALSNSRTQKIYIDSIAAERGF---NNLEVHT 175 >UniRef50_Q1D8F1 Cluster: D-aminopeptidase; n=5; Bacteria|Rep: D-aminopeptidase - Myxococcus xanthus (strain DK 1622) Length = 419 Score = 31.5 bits (68), Expect = 3.8 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 168 GGGTFLSCHQVKRNVPTATTAIAPSAKALAADVLLPC 58 GGGT + CH K + TA+ + S VLL C Sbjct: 198 GGGTGMVCHSFKAGIGTASRKLPESEGGYTVGVLLQC 234 >UniRef50_Q6ALP6 Cluster: Putative uncharacterized protein; n=1; Desulfotalea psychrophila|Rep: Putative uncharacterized protein - Desulfotalea psychrophila Length = 225 Score = 30.7 bits (66), Expect = 6.6 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = -1 Query: 197 FADSRLELRAVGEPSFLATK*REMFRPPQPP 105 F ++ +L+AVG+P+FL T +++F P PP Sbjct: 100 FRNNLPDLQAVGDPAFLITDDKKIFILPPPP 130 >UniRef50_Q4CWK8 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 508 Score = 30.7 bits (66), Expect = 6.6 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 105 WRLWRSEHFSLLGGKK 152 W+ WR +HFSL GG++ Sbjct: 150 WKCWRDKHFSLFGGRE 165 >UniRef50_UPI000049A291 Cluster: hypothetical protein 74.t00024; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 74.t00024 - Entamoeba histolytica HM-1:IMSS Length = 408 Score = 30.3 bits (65), Expect = 8.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -3 Query: 168 GGGTFLSCHQVKRNVPTATTAIAPSAKALAADVLLPCEL 52 GG +SC V+ A+ PS K A++V PCE+ Sbjct: 249 GGSCLVSCKCVQSIYKNVQPAMIPSEKDYASNVAFPCEV 287 >UniRef50_A4I4B2 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania infantum Length = 578 Score = 30.3 bits (65), Expect = 8.7 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -3 Query: 174 PCGGGTFLSCHQVKRNVPTATTAIAPSAKALAADVLLPCELEFLVIAKWQ 25 PCG +L+CH P T P A + V PC ++L ++W+ Sbjct: 323 PCGHLCWLTCHDETPCAPCKETVTVPCACG-SRHVSCPCFCQYLPESEWE 371 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 310,374,168 Number of Sequences: 1657284 Number of extensions: 5397943 Number of successful extensions: 13647 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13647 length of database: 575,637,011 effective HSP length: 80 effective length of database: 443,054,291 effective search space used: 10190248693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -