BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g04r (481 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 190 2e-50 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 27 0.33 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 2.4 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 3.1 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 5.4 AF203337-1|AAF19832.1| 184|Anopheles gambiae immune-responsive ... 23 7.2 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 190 bits (464), Expect = 2e-50 Identities = 96/140 (68%), Positives = 112/140 (80%), Gaps = 1/140 (0%) Frame = -2 Query: 453 MADQTE-RSFQKQPTVFLNRKKGIGVKRSRKPLRYHKDVGLGFKTPREAIEGTYIDKKCP 277 MADQ R+FQKQ + LNRK V R +K LR H +GLGFKTP+EAI GTYIDKKCP Sbjct: 1 MADQQNIRAFQKQLGINLNRKN---VSR-KKGLRMHHSIGLGFKTPKEAITGTYIDKKCP 56 Query: 276 FTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVE 97 FTG++SIRGRILTGVV+K + + IRRDYL ++ KY+ FEKR+RNM +HLSPCFRDVE Sbjct: 57 FTGHISIRGRILTGVVRKCIV--LLYIRRDYLQFIRKYDTFEKRNRNMRLHLSPCFRDVE 114 Query: 96 IGDIVTIGECRPLSKTVRFN 37 GDIVT+GECRPLSKTVRFN Sbjct: 115 AGDIVTLGECRPLSKTVRFN 134 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 27.1 bits (57), Expect = 0.33 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -2 Query: 459 SKMADQTERSFQKQPTVFLNRKKGIGVK 376 +KMAD T+R++ + P +F++ G +K Sbjct: 614 TKMADGTQRAYVRLPAMFVSELDGTKIK 641 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 2.4 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 238 GEDAAADRNVASEGTLLVNVGT-LNRLTGSLETEAHILVVSQRFSAPLHTNTFLAVQKDC 414 GED D+ S+GTLL +GT N + + T+ + +R ++ + +FL DC Sbjct: 1268 GEDDTGDKKTDSDGTLL-EIGTWSNEMAVGVGTDNDMGEEGRRGAS---SPSFLRYDSDC 1323 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.8 bits (49), Expect = 3.1 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 271 SEGTLL-VNVGTLNRLTGSLETEAHILVVSQRFSAPLHTNTFLAV 402 ++G +L +++GTL++L GSL E + +P H L++ Sbjct: 303 AQGDVLELDIGTLDQLAGSLADELTLQQNDYFKGSPAHRKPLLSM 347 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.0 bits (47), Expect = 5.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 316 TGSLETEAHILVVSQRFS 369 TGS+E+ AH+L RF+ Sbjct: 951 TGSVESVAHVLFYCPRFA 968 >AF203337-1|AAF19832.1| 184|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR9 protein. Length = 184 Score = 22.6 bits (46), Expect = 7.2 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -1 Query: 457 QNGGSDGTLIPKTTYSLSEPQERYWCEAEQKTVEIPQGCGPRFQD 323 Q GG GT K P + KTV +PQ CG R D Sbjct: 21 QGGGVKGTQPDKVGTGTQNPLD--------KTVSVPQKCGLRNVD 57 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 497,169 Number of Sequences: 2352 Number of extensions: 9821 Number of successful extensions: 18 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 41863041 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -