BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10g01f (633 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schiz... 28 1.3 SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyce... 28 1.3 SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Ma... 27 3.0 SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac... 26 5.2 SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex ... 25 9.1 SPAC17A2.11 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 9.1 >SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 27.9 bits (59), Expect = 1.3 Identities = 20/54 (37%), Positives = 26/54 (48%) Frame = +3 Query: 30 CIMKTFIVFVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFK 191 C + F+V V V A LTDE+K L K R + S + E+L K FK Sbjct: 233 CAIVIFLVLPVSVETANFLTDEEK-TLAKMRIENDSSSAISEKLSFKQSLTVFK 285 >SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyces pombe|chr 1|||Manual Length = 469 Score = 27.9 bits (59), Expect = 1.3 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 9/70 (12%) Frame = +3 Query: 183 DFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKVPN------AEDKLKVEKLIDA- 341 DF EN+ + +L + + ++ KDG + +D+ + N A +K K E DA Sbjct: 84 DFMDENKENGRISLGLSVIVRVTIKDGAYHEDIGYGSIDNCRGKASAFEKCKKEGTTDAL 143 Query: 342 --CLANKGNS 365 L N GNS Sbjct: 144 KRALRNFGNS 153 >SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 629 Score = 26.6 bits (56), Expect = 3.0 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +3 Query: 33 IMKTFIVFVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGD-FKTENEPL 209 I+ TF++FVV ++L + L ++ K+ + + + E KL GD F+ P+ Sbjct: 274 IIDTFLIFVVSIILYRTL----NRDINKYNSAFVDQEDVQEDFGWKLVHGDVFRPPRRPM 329 >SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 848 Score = 25.8 bits (54), Expect = 5.2 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +3 Query: 69 VLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYA 221 V + +TD N+ + L E + + ++K KT DFK + + YA Sbjct: 621 VASDKITDSSPGNMSEASESELEEVFKNPKELSKKKTTDFKDKEYYMSHYA 671 >SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex subunit Sld3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 668 Score = 25.0 bits (52), Expect = 9.1 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 445 IQPNRSIPH*C*IARTCLSRRYHDY 519 + P ++P C R C+S+ YH++ Sbjct: 26 VWPLVTVPRQCICLRWCISKEYHEF 50 >SPAC17A2.11 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 217 Score = 25.0 bits (52), Expect = 9.1 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = -3 Query: 355 LLARQASISFSTFNLSSALGTLARATSFLNFPSLVISCDLISIHRAYFFNGSFSVLKSPV 176 LL Q +S S F++S + SFL+FP ++S L + + SFS L SP Sbjct: 159 LLYHQIILSHSLFHISHLISFHFLFFSFLSFP--LLSFILFPCFSLFLSSNSFS-LASPF 215 Query: 175 FS 170 S Sbjct: 216 SS 217 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,647,034 Number of Sequences: 5004 Number of extensions: 54529 Number of successful extensions: 177 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 281707720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -