BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f24r (497 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 5.4 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 7.1 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 7.1 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 7.1 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 9.4 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 462 WLRSTKPSRKSVFSGSSLTGELISISSLICPMSNSW 355 W RKS S +SL LI ++ CP+ SW Sbjct: 218 WKNDEGTLRKSP-SLTSLNAYLIKNQTITCPIKVSW 252 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 462 WLRSTKPSRKSVFSGSSLTGELISISSLICPMSNSW 355 W RKS S +SL LI ++ CP+ SW Sbjct: 218 WKNDEGTLRKSP-SLTSLNAYLIKNQTITCPIKVSW 252 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 462 WLRSTKPSRKSVFSGSSLTGELISISSLICPMSNSW 355 W RKS S +SL LI ++ CP+ SW Sbjct: 269 WKNDEGTLRKSP-SLTSLNAYLIKNQTITCPIKVSW 303 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 462 WLRSTKPSRKSVFSGSSLTGELISISSLICPMSNSW 355 W RKS S +SL LI ++ CP+ SW Sbjct: 218 WKNDEGTLRKSP-SLTSLNAYLIKNQTITCPIKVSW 252 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 83 CKAR*TRYRCYTQLKVHS 30 CKA + C QLKVH+ Sbjct: 206 CKACGKGFTCSKQLKVHT 223 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 7.1 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = -1 Query: 299 NGIGQEAASRQERGSSE*EARDREDSLEKHDHRSRDGRFNCRHLQRKNF 153 N E R+ R +S+ +RDR++ + +H+ N + N+ Sbjct: 48 NSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNNNY 96 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 7.1 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = -1 Query: 299 NGIGQEAASRQERGSSE*EARDREDSLEKHDHRSRDGRFNCRHLQRKNF 153 N E R+ R +S+ +RDR++ + +H+ N + N+ Sbjct: 48 NSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNNNY 96 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 7.1 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = -1 Query: 299 NGIGQEAASRQERGSSE*EARDREDSLEKHDHRSRDGRFNCRHLQRKNF 153 N E R+ R +S+ +RDR++ + +H+ N + N+ Sbjct: 48 NSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNNNY 96 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 20.6 bits (41), Expect = 9.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 5 VVLDALLERNEP*AVCSTDTGSTVLYRL 88 V+++ LL VC T ++ LYRL Sbjct: 13 VIINVLLHGQVICFVCKDITSTSALYRL 40 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,162 Number of Sequences: 438 Number of extensions: 2274 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -