BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f23f (608 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 33 0.20 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 33 0.20 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 29 3.2 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 29 3.2 At4g10950.1 68417.m01780 GDSL-motif lipase/hydrolase family prot... 29 3.2 At3g47620.1 68416.m05184 TCP family transcription factor, putati... 29 3.2 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 28 5.6 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 32.7 bits (71), Expect = 0.20 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 120 MSSSNKELE-EKLY--NSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDKSR 278 M N+ E EKL+ NS L+ Y ++ S ++ENQ K + QNV ++DK R Sbjct: 288 MEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 343 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 32.7 bits (71), Expect = 0.20 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 120 MSSSNKELE-EKLY--NSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDKSR 278 M N+ E EKL+ NS L+ Y ++ S ++ENQ K + QNV ++DK R Sbjct: 289 MEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 344 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 150 KLYNSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLII 266 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 150 KLYNSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLII 266 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g10950.1 68417.m01780 GDSL-motif lipase/hydrolase family protein similar to family II lipase EXL1 GI:15054382 from [Arabidopsis thaliana]; contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase Length = 400 Score = 28.7 bits (61), Expect = 3.2 Identities = 25/111 (22%), Positives = 53/111 (47%), Gaps = 2/111 (1%) Frame = +3 Query: 93 GVTEMSAGS--MSSSNKELEEKLYNSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLII 266 GV SAG+ + SS EL +++ ++ + +Q + + K S + +V+N + Sbjct: 143 GVNYASAGAGIILSSGSELGQRVSFAMQVEQFVDTFQQMILSIGE-KAS--ERLVSNSVF 199 Query: 267 DKSRNTMEYCYKLWVGNGQHIVRKYFPYNFRLIMAGNFVKLIYRNYNLALK 419 S +Y + ++ N ++ Y P+NF +A N + + YN+ ++ Sbjct: 200 YISIGVNDYIH-FYIRNISNVQNLYTPWNFNQFLASNMRQELKTLYNVKVR 249 >At3g47620.1 68416.m05184 TCP family transcription factor, putative auxin-induced basic helix-loop-helix transcription factor - Gossypium hirsutum, EMBL:AF165924 Length = 489 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/73 (21%), Positives = 30/73 (41%) Frame = -1 Query: 233 GALALVLVFQALTDSAVVVTGEDAVVQFLLEFFVRTAHASRGHFSDAGADGEHARREHHE 54 GA++ L F +TG+ + ++ + G SD G D + +R HH Sbjct: 391 GAVSSGLHFMNFAAPMAFLTGQQQLATTSNHEINEDSNNNEGGRSDGGGDHHNTQRHHHH 450 Query: 53 KFHYHSCLFRSLS 15 + +H + L+ Sbjct: 451 QQQHHHNILSGLN 463 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 27.9 bits (59), Expect = 5.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 258 LIIDKSRNTMEYCYKLWVGNGQHIVRKYFPYNF 356 +++D EY KL + +G KYFP F Sbjct: 386 IVVDTKNLNCEYQLKLMIASGVDAANKYFPLAF 418 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,895,210 Number of Sequences: 28952 Number of extensions: 232551 Number of successful extensions: 700 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -