BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f22f (617 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49400.1 68416.m05400 transducin family protein / WD-40 repea... 34 0.066 At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 31 0.81 At5g63450.1 68418.m07965 cytochrome P450, putative 30 1.1 At3g48520.1 68416.m05296 cytochrome P450 family protein similar ... 30 1.4 At4g39510.1 68417.m05587 cytochrome P450 family protein contains... 29 1.9 At5g64820.1 68418.m08155 hypothetical protein 29 3.3 At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-... 29 3.3 At3g30550.1 68416.m03866 hypothetical protein includes At2g05890... 29 3.3 At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative simila... 29 3.3 At5g03800.1 68418.m00347 exostosin family protein / pentatricope... 28 4.3 At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identica... 28 4.3 At5g16590.1 68418.m01942 leucine-rich repeat transmembrane prote... 28 5.7 At2g04620.1 68415.m00470 cation efflux family protein potential ... 28 5.7 At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family pr... 28 5.7 At5g07400.1 68418.m00847 forkhead-associated domain-containing p... 27 7.5 At4g28590.1 68417.m04089 expressed protein 27 7.5 At5g19100.1 68418.m02272 extracellular dermal glycoprotein-relat... 27 10.0 At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 27 10.0 At1g59453.1 68414.m06679 transcription factor-related weak simil... 27 10.0 At1g59077.1 68414.m06670 hypothetical protein 27 10.0 At1g58766.1 68414.m06659 hypothetical protein 27 10.0 At1g20410.1 68414.m02545 expressed protein 27 10.0 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 27 10.0 >At3g49400.1 68416.m05400 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); low similarity (47%) to Agamous-like MADS box protein AGL5 (SP:P29385) {Arabidopsis thaliana} Length = 892 Score = 34.3 bits (75), Expect = 0.066 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 8/76 (10%) Frame = -1 Query: 500 LPQSNELPADFRACFVLTVAEGKSAIVAV--------NIITQRQSETVALVHKLNGVFGE 345 L + +LP DF +C + ++ G A+ V N + Q +S+ A+ NG Sbjct: 482 LSSTTDLPDDFLSCLGVALSPGNLAVALVRNFNVELLNPMYQARSQKAAVEFLWNGAQQS 541 Query: 344 DKSELNWETITDDVLG 297 +SE + ET+T+ +LG Sbjct: 542 GESEDSTETVTEAILG 557 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 30.7 bits (66), Expect = 0.81 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +3 Query: 48 PVIVILCLFVASLYAADSDVPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNV 227 P +I+ + V +L S +P D+L++ L D DSA +K E K + N+ Sbjct: 161 PSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKMGSIAPNL 220 >At5g63450.1 68418.m07965 cytochrome P450, putative Length = 510 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +3 Query: 447 GKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVG 566 G+D TS ++W F L +N+ V KIL+ RN+ LG+G Sbjct: 306 GRDTTSAAMTWLFWLLSQNDDVETKILDELRNKG-SLGLG 344 >At3g48520.1 68416.m05296 cytochrome P450 family protein similar to Cytochrome P450 94A1 (P450-dependent fatty acid omega-hydroxylase) (SP:O81117) {Vicia sativa}; contains Pfam profile: PF00067 cytochrome P450 Length = 506 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +3 Query: 447 GKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVG 566 G+D TS ++W F L EN+ V KIL E + + LG+G Sbjct: 304 GRDTTSAAMTWLFWLLTENDDVERKILE-EVDPLVSLGLG 342 >At4g39510.1 68417.m05587 cytochrome P450 family protein contains Pfam PF00067: Cytochrome P450; similar to Cytochrome P450 86A2 (SP:O23066) [Arabidopsis thaliana] Length = 508 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 393 LTLSNDVHGNDGRLAFG-DGKDKTSPKVSWKFIALWENNKVYFKI 524 L S+D D LAF G+D TS +SW F L EN +V KI Sbjct: 293 LNPSDDKFLRDTILAFNLAGRDTTSSALSWFFWLLSENPQVVTKI 337 >At5g64820.1 68418.m08155 hypothetical protein Length = 145 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -1 Query: 461 CFVLTVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETI 315 C ++ + G SA A + ++ E ++V ++G+FG +WE I Sbjct: 15 CIIIILISGVSADGAESDSAAKKEENPSIVKIISGIFGNKFPPSSWELI 63 >At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-box RNA helicase [Chlamydomonas reinhardtii] GI:12044832; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1226 Score = 28.7 bits (61), Expect = 3.3 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = -1 Query: 596 EGHVVAVRVSTDSQYQILVTLSVQDLEVDLVVLPQSNELPADFRACFVLTVAEG-KSAIV 420 + + A S + + LV+ S +++ +L++LP ++LPAD +A +G + IV Sbjct: 747 QDEIEAACFSLKERMEQLVSSSSREI-TNLLILPIYSQLPADLQAKIFQKPEDGARKCIV 805 Query: 419 AVNI 408 A NI Sbjct: 806 ATNI 809 >At3g30550.1 68416.m03866 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 509 Score = 28.7 bits (61), Expect = 3.3 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +3 Query: 30 NAPKMKPVIVILCLFVASLYAA-DSDVPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKK 206 N K K +LC+ +++ DS + + + + IV DYD+ V+ S + E+ Sbjct: 395 NCLKGKTFQFLLCVQRENIFGGYDSFTVARVYTDNIADEIVQEDYDAYVDPSSLISIEQD 454 Query: 207 SEVITNVVN 233 S ++TN V+ Sbjct: 455 SLMLTNGVD 463 >At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative similar to gb|L13612 DEAD-box protein (dbp45A) from Drosophila melanogaster and is a member of PF|00270 DEAD/DEAH box helicase family Length = 491 Score = 28.7 bits (61), Expect = 3.3 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = -1 Query: 515 VDLVVLPQSNELPADFRACFVLTVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKS 336 VDLV+ P D+ T G+ + AV+IIT+ V L+HK+ G+ Sbjct: 371 VDLVINYDIPRDPRDYVHRVGRTARAGRGGL-AVSIITETD---VKLIHKIEEEVGKKME 426 Query: 335 ELNWETITDDV 303 N + ITD + Sbjct: 427 PYNKKVITDSL 437 >At5g03800.1 68418.m00347 exostosin family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles: PF03016 exostosin family, PF01535 PPR repeat Length = 1388 Score = 28.3 bits (60), Expect = 4.3 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -2 Query: 559 PNTKYWLRSVFKILK*TLLFSHRAMNFQLTFGLV 458 PNT+Y L+ V + +K + LF H A +T+G++ Sbjct: 806 PNTEYVLQEVDEFMKKSFLFHHSA-KLAVTYGIL 838 >At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identical to Anthocyaninless2 [Arabidopsis thaliana] GI:5702094 Length = 802 Score = 28.3 bits (60), Expect = 4.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 528 NTERNQYLVLGVGTNPNGDHMAF 596 N N L L VGTN NG H AF Sbjct: 270 NHHYNSSLELAVGTNNNGGHFAF 292 >At5g16590.1 68418.m01942 leucine-rich repeat transmembrane protein kinase, putative Length = 625 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -1 Query: 365 LNGVFGEDKSELNWETITDDVLGALEPKLIGVLHAVHLVVSY 240 L+G G +S LNWET + LGA + I LH+ S+ Sbjct: 427 LHGNKGSGRSPLNWETRANIALGA--ARAISYLHSRDATTSH 466 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -1 Query: 137 VKLLLQNVVRDVGICSIQRCHEKT*NNYD 51 +K ++N+++ G+CSIQR H + N D Sbjct: 727 LKEAMRNILKTKGVCSIQRLHVWSFTNSD 755 >At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family protein similar to CHY1 [gi:8572760]; contains Pfam profile PF00388 enoyl-CoA hydratase/isomerase family protein Length = 387 Score = 27.9 bits (59), Expect = 5.7 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 4/118 (3%) Frame = +3 Query: 207 SEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRL---IFAENAIKLMYK 377 +E IT V+ L R++ ++ Q +G K + DC EFRL I + MY Sbjct: 263 NEWITPVIKGLKRSSPTG-LKIVLQSIREGRKQTLSDCLKKEFRLTLNILRKTISPDMY- 320 Query: 378 RDGL-ALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQY 548 +G+ ALT+ D + D+ K++ F L+E++ + +I TE N++ Sbjct: 321 -EGIRALTIDKDNSPKWNPATLDEVDDE---KINSVF-KLFEDDDIELQIPETEENRW 373 >At5g07400.1 68418.m00847 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 1084 Score = 27.5 bits (58), Expect = 7.5 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = -1 Query: 473 DFRACFVLT--VAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETITDDVL 300 D R FV+ V EG+ A + V++ + T + + VF ++E+N V Sbjct: 153 DGRVGFVVQEIVFEGRDASI-VSVSSGHSRGTFSSGKRSKRVFAPMENEIN-----SPVS 206 Query: 299 GALEPKLIGVLHAVHLVVSY 240 G PK +GV+ V+ +VSY Sbjct: 207 GFYPPKAVGVVERVNSLVSY 226 >At4g28590.1 68417.m04089 expressed protein Length = 331 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 371 HKLNGVFGEDKSELNWETITDD 306 H + V G+D SE++WE DD Sbjct: 180 HPIKNVVGDDGSEIDWEGEIDD 201 >At5g19100.1 68418.m02272 extracellular dermal glycoprotein-related / EDGP-related low similarity to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741, SP|P13917 Basic 7S globulin precursor {Glycine max} Length = 391 Score = 27.1 bits (57), Expect = 10.0 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -1 Query: 389 ETVALVHKLNGVFGEDKSELNWETIT-DDVLGALEPKLIGVLHAVHLVVSYQFV 231 +TV L++ NGV+ D + T+T D AL+ + IG+ + HL + Q + Sbjct: 122 DTVPLLYTFNGVYTRDSEMSSSLTLTCTDGAPALKQRTIGLAN-THLSIPSQLI 174 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 298 PRTSSVIVSQLSSDLSSPKTPLSLCTSATVS 390 PR + S L SDL P+T + CTS V+ Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTSVGVA 201 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 120 LEEQLYNSIVVADYDSAVEKSKHLYEEKKSEV-ITNV 227 LEE N +V +DY ++ +K H+ E +V I N+ Sbjct: 1545 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 1581 >At1g59077.1 68414.m06670 hypothetical protein Length = 665 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 120 LEEQLYNSIVVADYDSAVEKSKHLYEEKKSEV-ITNV 227 LEE N +V +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g58766.1 68414.m06659 hypothetical protein Length = 665 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 120 LEEQLYNSIVVADYDSAVEKSKHLYEEKKSEV-ITNV 227 LEE N +V +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g20410.1 68414.m02545 expressed protein Length = 504 Score = 27.1 bits (57), Expect = 10.0 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 4/96 (4%) Frame = +3 Query: 54 IVILCLFVASLYAADSDVPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVN 233 I I+CL + L SDV ++++ +S VA V++ +H ++ EV +V + Sbjct: 97 ICIVCLGI--LQFVFSDVKKELVKSDS-SSDYVARITDLVKQDRHEFDSFGLEV--SVPS 151 Query: 234 KLIRNNKMNCM----EYAYQLWLQGSKDIVRDCFPV 329 ++ N + +Y+ ++WLQ K V+D V Sbjct: 152 TIMENERALLSYLKGKYSTEVWLQRDKISVKDALKV 187 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 27.1 bits (57), Expect = 10.0 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +1 Query: 73 SWHLCMLQIPTSLTTFWRSSFTIASSLPITTV 168 +W + +L +P ++ FW + +ASS + + Sbjct: 1086 TWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,120,359 Number of Sequences: 28952 Number of extensions: 232127 Number of successful extensions: 917 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 917 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -