BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f21r (722 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067950-3|AAG24158.2| 371|Caenorhabditis elegans Serpentine re... 29 3.4 Z69883-3|CAA93741.2| 450|Caenorhabditis elegans Hypothetical pr... 28 7.8 >AF067950-3|AAG24158.2| 371|Caenorhabditis elegans Serpentine receptor, class w protein137 protein. Length = 371 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 207 KFLFYKSIIKIHCVLLNFMYSKELSPTSTK 296 K L Y+SII I C+L+N ++S L+ S + Sbjct: 35 KVLSYESIISITCILVNILHSAILTRKSMR 64 >Z69883-3|CAA93741.2| 450|Caenorhabditis elegans Hypothetical protein C27C12.4 protein. Length = 450 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 351 SFKIVHLCIK*TSIIYSVTTSFYLKLQINLVSILCYI 461 SF + +LC+ S ++S S YL +NL I+ ++ Sbjct: 325 SFILAYLCLPYDSTVHSTDASTYLAPTLNLTLIISFL 361 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,688,828 Number of Sequences: 27780 Number of extensions: 279668 Number of successful extensions: 516 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 516 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -