BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f14r (465 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 25 0.35 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 1.1 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 23 1.1 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 4.3 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 5.6 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 7.4 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.0 bits (52), Expect = 0.35 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 243 PDVVFVFGFKTNFGGGKSTG 184 PD VF+ F+T+F GK +G Sbjct: 107 PDDVFIRKFETSFESGKPSG 126 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = -1 Query: 171 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 49 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 233 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 280 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = -1 Query: 171 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 49 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 15 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 62 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.4 bits (43), Expect = 4.3 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 391 RNSDYSHSQVHDQQIVGAQADGLRCFTS 308 R DY + + DQ +V +G+R +S Sbjct: 178 RCKDYKNEDLEDQPVVYNDVNGVRINSS 205 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 5.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 360 MTNRLLARKQMVCDVLHPGKPTV 292 +TN+ Q++ + LH KPTV Sbjct: 134 LTNKSNGNGQIMLNSLHKYKPTV 156 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 20.6 bits (41), Expect = 7.4 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = -3 Query: 247 YSRCSVRIRFQDKLRRWQVNWI 182 Y+ +R++FQ KL +++W+ Sbjct: 341 YASNCLRVQFQKKLLLVELSWM 362 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,476 Number of Sequences: 336 Number of extensions: 2519 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10721526 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -