BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f14f (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_32823| Best HMM Match : Late_protein_L1 (HMM E-Value=2.5) 30 0.93 SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_18070| Best HMM Match : V-ATPase_G (HMM E-Value=4) 29 2.2 SB_44985| Best HMM Match : YhjQ (HMM E-Value=0.37) 29 2.2 SB_6351| Best HMM Match : IncA (HMM E-Value=0.13) 29 2.2 SB_43681| Best HMM Match : MAM (HMM E-Value=2.5e-20) 28 5.0 SB_24027| Best HMM Match : FAD_binding_7 (HMM E-Value=0) 28 5.0 SB_22216| Best HMM Match : PGAMP (HMM E-Value=4) 28 5.0 SB_16395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 27 6.6 SB_43942| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_899| Best HMM Match : Alpha_L_fucos (HMM E-Value=0) 27 8.7 >SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 31.1 bits (67), Expect = 0.53 Identities = 21/70 (30%), Positives = 34/70 (48%) Frame = -2 Query: 384 FARGPLLLVQAVAG*PVLGLELLGQIECVVDQSESS*LATSEVCLETEYEHYIGSNLVHF 205 F +G L + V ++GLEL +I+ ++D++ S CL +E + N F Sbjct: 56 FFQGDSTLKEPVQKILIIGLELAKEIQKLIDEASSGLNIKHAACLPSEVPAF--CNTERF 113 Query: 204 GELLTDLGLA 175 G LL D+ A Sbjct: 114 GLLLVDVRCA 123 >SB_32823| Best HMM Match : Late_protein_L1 (HMM E-Value=2.5) Length = 585 Score = 30.3 bits (65), Expect = 0.93 Identities = 24/76 (31%), Positives = 39/76 (51%) Frame = +3 Query: 159 RKTNRQQDRDP*EARQNVQGYSRCSVRIRFQDKLRRWQVNWIRFDLRHTRSGQEVRAQAQ 338 R+T++ DR A+ NV S V++R D ++ V+ ++ D R + SGQ+V ++ Sbjct: 281 RRTSQSNDR----AQGNVTVVSTAHVQVRADD-VQAMNVSGVKSDGRPSSSGQDVYDGSR 335 Query: 339 VSPPRPVREEEAHAQT 386 S P E AQT Sbjct: 336 QSTHGPALPWEELAQT 351 >SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -2 Query: 231 YIGSNLVHFGELLTDLGLADGWFSWM*NIANHLLARQQSVGHELASANS 85 +I N +F + DLG+A + + + +H L R Q+VGH A S Sbjct: 289 FIDFNDFYFSNRVVDLGIALAYIMMLPQVNSH-LTRPQAVGHMFAGYQS 336 >SB_18070| Best HMM Match : V-ATPase_G (HMM E-Value=4) Length = 166 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 331 KHRLARHGLYEKKRPTRKQRKERKNRMKKVR 423 +H LA H +++RP+ R+ K R++K+R Sbjct: 79 RHGLASHDKKKRERPSLVARERMKKRLRKIR 109 >SB_44985| Best HMM Match : YhjQ (HMM E-Value=0.37) Length = 1376 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +1 Query: 304 LDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKV 420 LDL KHR RH EKK K RK +KN M+++ Sbjct: 1000 LDLLLAHATKHRGRRHRS-EKKEKANKARKCQKNYMRRL 1037 >SB_6351| Best HMM Match : IncA (HMM E-Value=0.13) Length = 417 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 331 KHRLARHGLYEKKRPTRKQRKERKNRMKKVR 423 +H LA H +++RP+ R+ K R++K+R Sbjct: 378 RHGLASHDKKKRERPSLVARERMKKRLRKIR 408 >SB_43681| Best HMM Match : MAM (HMM E-Value=2.5e-20) Length = 1468 Score = 27.9 bits (59), Expect = 5.0 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -3 Query: 257 FVLKPNTNTTSGVTL---YILASFSRISVLLTVGFPGCKTSQT 138 F+ PN ++ TL ++ S R+ V+ +VG PGC S T Sbjct: 904 FISIPNITISNTFTLSWWMLVQSVQRVYVMTSVGNPGCGASPT 946 >SB_24027| Best HMM Match : FAD_binding_7 (HMM E-Value=0) Length = 1074 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -2 Query: 207 FGELLTDLGLADGWFSWM*NIANHLLA 127 FGEL+ D G + F+W+ N++N +LA Sbjct: 76 FGELMLDAGWSRNAFNWL-NMSNSMLA 101 >SB_22216| Best HMM Match : PGAMP (HMM E-Value=4) Length = 132 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 391 YAVCAWASSSRTGRGGLTCAWARTSWPDRVCRRSKRIQL-TCHLRS 257 Y CA S G+ C +A + PD RRS R T H RS Sbjct: 62 YGTCAMPDSGIPPPPGVLCRYAPCAMPDPKMRRSNRSSSGTTHNRS 107 >SB_16395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 328 PKHRLARHGLYEKKRPTRKQRKERKNRMKK 417 P+ L H L ++ R R+QR ER++R+K+ Sbjct: 21 PQQILFTHRLEQRYRVERRQRLERRHRVKR 50 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = -3 Query: 254 VLKPNTNTTSGVTLYILASFSRISVLLTVGFPGCKTSQTICLRANNLLVM 105 V+ NT ++ +T +F I +++T C++S TI + NN + + Sbjct: 137 VIINNTIISTKITTSTTTTFIIIIIIITTSSHHCRSSTTIVVTTNNTITI 186 >SB_43942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 973 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 152 KTSQTICLRANNLLVMN-LRVRIVAVPSLILNYFQ*FGVYTH 30 K S + LR +NL + + RIV P ++Y + FG+Y H Sbjct: 245 KRSPKMILRLHNLCWRHAMSCRIVPTPPKAISYRKLFGIYFH 286 >SB_899| Best HMM Match : Alpha_L_fucos (HMM E-Value=0) Length = 1127 Score = 27.1 bits (57), Expect = 8.7 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 319 KFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVR 423 KFEPKH+ + KKR +RK+ E + + + +R Sbjct: 1060 KFEPKHK-KKGRSSSKKRHSRKKGHEEQQKKETIR 1093 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,217,272 Number of Sequences: 59808 Number of extensions: 337101 Number of successful extensions: 973 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 968 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -