BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f14f (502 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 4.1 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 5.5 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 5.5 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 7.2 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 9.5 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 9.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.5 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 250 KTNFGGGKSTGFALIYDTLDLA 315 KTN G S+G L+ + D+A Sbjct: 724 KTNLSGDSSSGTTLLLELDDIA 745 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.4 bits (43), Expect = 5.5 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = -3 Query: 113 LVMNLRVRIVAVPSLILNYFQ*FGVYTHVSLLKQE 9 LVM+ +++I+ + IL+ + + +S+ KQE Sbjct: 43 LVMDTKLKIIEILQFILDVRLDYRISCLLSIFKQE 77 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 21.4 bits (43), Expect = 5.5 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = -3 Query: 113 LVMNLRVRIVAVPSLILNYFQ*FGVYTHVSLLKQE 9 LVM+ +++I+ + IL+ + + +S+ KQE Sbjct: 11 LVMDTKLKIIEILQFILDVRLDYRISCLLSIFKQE 45 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = -1 Query: 343 LTCAWARTSWPDRVCRRSKRIQLTCHLRS 257 L ++ R P +C R LT H RS Sbjct: 107 LKFSYPRMRAPSFICENETRQGLTLHYRS 135 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 148 VLHPGKPTVSKTEIREK 198 +LHP + T K REK Sbjct: 15 LLHPSRCTQGKVNYREK 31 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 148 VLHPGKPTVSKTEIREK 198 +LHP + T K REK Sbjct: 15 LLHPSRCTQGKVNYREK 31 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +3 Query: 60 IQNE*RNSDYSHS 98 I++E NSDYSH+ Sbjct: 224 IKHESDNSDYSHT 236 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,959 Number of Sequences: 438 Number of extensions: 3112 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -