BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f13f (595 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 24 1.3 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 1.7 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 76 KYNQICLFYHSCWVTGPAFVTTTGPVVLLIKILDW 180 +Y+ + +++H G + GP VLL+ +L W Sbjct: 199 EYSMLLVYFHLQRHMGNFLIQVYGPCVLLV-VLSW 232 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 23.4 bits (48), Expect = 1.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 389 HHDVPIGSLHRNLFRREVLHVQ 324 H D+PI H +L +VL+ Q Sbjct: 64 HRDLPIYQSHHHLHHHQVLYQQ 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,797 Number of Sequences: 438 Number of extensions: 3505 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -