BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f12r (790 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4172| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_58889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 >SB_4172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 365 YTFFQVLTTPSEASPPTSETLHTLRDQSLFFLINAKS 475 Y F +V+T+P +A+PP SE T+R F +AK+ Sbjct: 49 YCFVEVMTSPPQATPPHSENNKTVRHLGRHFTGHAKN 85 >SB_58889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +2 Query: 365 YTFFQVLTTPSEASPPTSETL 427 Y F +V+T+P +A+PPT T+ Sbjct: 36 YCFIEVMTSPPQATPPTVRTI 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,638,046 Number of Sequences: 59808 Number of extensions: 280198 Number of successful extensions: 473 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -